ELF([44 ("!     $$QtdRtd   \\GNU *nݛK$;5 E@!!!aDXPDX"@@$ B/Cl"0*  A݈xъ (3\#4;2B      !"#$%&'()*,-./01345689:;<=>?@ABDEGIJLMPQRSTUVWZ[\aHacs'j$vEa%8y'ΎK0MӅCO$a3qW6:G jLE>HWyeT5BògG7Y{ 1i_=rs1F?iXZfɔQѳ\MtoBE>Ɗ ޤ;풊޾G^>`*%exLPIV??\@}]|3W;88Wc_ݟBB>CʯQ_4|rv%`fWIߠK}Y+ሢ.ex#1<|j{+8eqaxmc|C>OhXJ'Mtd.m{%iq-Wn.O B MC} $L"h% - d@, Jy sXW*f l i  '^MXUB  V > j  B  So! _< z H ?k.>S 924 p WJ e F'   5   ][[ P   V $Cvn z-vS     2 Z e ,!  oBl 9H t X lP | 8 0,O { ( 4 _(  Fdd   | P4 t  }0 ^ ,($T. X   <T$ %~ UP ` ,,T ,1, P  ; T\ X i 1p 0 @\\  pL jx p+ ` al 9|$( ` ' l r L f F 8  Z D 4 8,bD<,|("   ? 0 h@   Pc T(Ox _ <,{ |H P$(54 W(  T , <,oe\  t )j, 8b P _D (Td   n| \ +` ̼  ^d 8D vP HT  %h0 oH^t &  ?b| : L  504 a P    ( +_$ /l \ A  \@  w+} `( ( l p   ,\ <,R$\  tH (_ 0 6  DT    4  ]+4  4,T`$ T(4 s+8 ( _ __gmon_start___fini_ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesbuffer_new_talloc_zerosysconfbuffer_getstrmemcpytall_vty_ctxbuffer_emptybuffer_reset_talloc_freebuffer_freebuffer_putbuffer_putcbuffer_putstrstrlenbuffer_flush_availablewritev__errno_locationbuffer_flush_allbuffer_writehostdefault_motd__ctype_b_locvty_outcmdvectalloc_strduptall_vty_cmd_ctxstpcpymkstempvty_newvty_closeunlink__xstatsyncchmodstrcmptalloc_strnduptalloc_named_constvfprintfvector_countstrtolstrncmpstrncpygetpidlog_check_levelkilllogp2logp_stubosmo_log_infovty_out_vavty_out_uptimevty_out_newlineconfig_help_cmdshow_vty_attr_all_cmdshow_vty_attr_cmdconfig_list_cmdconfig_exit_cmdconfig_end_cmdosmo_panicfopenfgetsfclosevty_config_lockvector_set_indexvector_initprint_versionargv_concatsort_nodeqsortcmd_make_strvec2vector_setcmd_make_strveccmd_free_strvecvector_freecmd_promptosmo_asciidoc_escapevty_dump_xml_ref_modevty_dump_xml_refinstall_elementinstall_lib_elementinstall_nodeinstall_element_veinstall_lib_element_vevty_cmd_range_matchstrtoulstrchrvector_copyvector_only_wrapper_freecmd_describe_commandvector_lookupcmd_complete_commandvty_go_parentvty_config_unlockcmd_execute_commandcmd_execute_command_strictconfig_from_filehost_config_setstrerrorhost_config_filevty_install_defaultosmo_vty_write_config_fileosmo_vty_save_config_filecmd_initsrandview_nodeauth_nodeauth_enable_nodeconfig_nodeosmo_clock_gettimevty_ref_gen_mode_descvty_ref_gen_mode_namesmemsetmemmove_talloc_reallocstrcpygetcwdchdirperrorvty_cwdvty_flushvty_shellvty_eventvsnprintfstdoutunamevty_current_indexvty_current_nodevector_unsetvty_hellovty_readvector_only_index_freevty_read_config_filepfilenofwritevty_createtcgetattrcfmakerawtcsetattrvty_get_bind_addrvty_get_bind_portvty_resetVvty_serv_threadvty_get_cwdvty_shell_servvty_init_vtyshtall_vty_vec_ctxvty_nodevty_read_config_filevector_ensurevector_empty_slotvector_lookup_ensurerate_ctr_for_each_counterosmo_stat_item_for_each_itemosmo_stat_item_get_descosmo_stat_item_get_lasttalloc_strndup_append_buffertalloc_strdup_append_buffertalloc_asprintf_appendvty_out_rate_ctr_group2vty_out_rate_ctr_groupvty_out_rate_ctr_group_fmt2vty_out_rate_ctr_group_fmtvty_out_stat_item_group2vty_out_stat_item_groupvty_out_statistics_partial2osmo_counters_for_eachrate_ctr_for_each_grouposmo_stat_item_for_each_groupvty_out_statistics_partialvty_out_statistics_full2vty_out_statistics_fullvty_cmd_string_from_valstr__ctype_tolower_locosmo_sock_init_ofdacceptosmo_sock_get_name_bufosmo_fd_registeractive_connectionstelnet_inittelnet_init_dyniftelnet_init_defaulttelnet_close_clientosmo_fd_unregisterlog_del_targetvty_is_activeosmo_signal_dispatchtelnet_exitlog_tgt_mutex_lock_impllog_target_findlog_target_destroylog_tgt_mutex_unlock_impllog_target_create_gsmtaplog_add_targetlog_target_create_rblog_target_file_switch_to_wqueuelog_target_file_switch_to_streamlog_target_create_fileget_value_stringosmo_str_tolower_bufget_value_string_or_nulllog_target_rb_avail_sizeosmo_log_target_listloglevel_strslog_parse_categorylog_parse_levelosmo_stderr_targetlog_target_create_syslogget_string_valuelog_target_create_stderrosmo_strrb_elementsosmo_strrb_get_nthtalloc_asprintftall_log_ctxassert_loginfotalloc_set_name_constlog_target_create_vtylog_target_createosmo_log_vty2tgtlog_level_strlog_set_log_levellog_cache_updatelog_parse_category_masklog_set_print_filename2log_set_print_filename_poslog_set_print_levellog_set_print_category_hexlog_set_print_categorylog_set_print_tidlog_set_print_extended_timestamplog_set_print_timestamplog_set_use_colorlog_set_all_filterlogging_vty_add_deprecated_subsyslogging_vty_add_cmdscfg_log_nodecfg_no_description_cmdcfg_description_cmdrate_ctr_group_resetosmo_stats_reportosmo_counters_countosmo_tcp_stats_configosmo_stats_configosmo_stats_reporter_listosmo_stats_tcp_set_intervalosmo_stats_set_intervalosmo_stats_reporter_findosmo_stats_reporter_freeosmo_stats_reporter_set_flush_periodosmo_stats_reporter_set_name_prefixosmo_stats_reporter_set_remote_addrosmo_stats_reporter_set_local_addrosmo_stats_reporter_set_mtuosmo_stats_reporter_set_remote_portosmo_stats_reporter_disableosmo_stats_reporter_enableosmo_stats_reporter_set_max_classosmo_stats_reporter_create_logosmo_stats_reporter_create_statsdosmo_stats_vty_add_cmdscfg_stats_nodeosmo_fsm_find_by_nameosmo_fsm_state_namevty_out_fsm2log_category_namevty_out_fsmosmo_g_fsmsvty_out_fsm_inst2osmo_fsm_event_namevty_out_fsm_instosmo_fsm_vty_add_cmdstalloc_get_nametalloc_total_blockstalloc_total_sizeregexectalloc_reference_count__tls_get_addrtalloc_report_depth_cbosmo_ctxregcompregfree__isoc99_sscanfosmo_talloc_vty_add_cmdssched_setscheduleropendirreaddir__sched_cpuallocsched_getaffinity__sched_cpufreeclosedirsched_setaffinitypthread_mutex_lockosmo_strlcpypthread_mutex_unlockosmo_str_to_int64osmo_cpu_sched_vty_initpthread_mutex_initosmo_cpu_sched_vty_apply_localthreadpthread_selfpthread_getname_nposmo_tdef_vty_parse_T_argosmo_str_to_intosmo_tdef_get_entryosmo_tdef_vty_parse_val_argstrtollosmo_tdef_vty_set_cmdosmo_tdef_val_in_rangeosmo_tdef_range_str_bufosmo_tdef_vty_out_one_vaosmo_tdef_unit_namesosmo_tdef_vty_out_oneosmo_tdef_vty_out_all_vaosmo_tdef_vty_show_cmdosmo_str_startswithosmo_tdef_vty_out_allosmo_tdef_vty_writeosmo_tdef_vty_groups_initosmo_tdefs_resetosmo_tdef_vty_groups_writelibosmocore.so.21libsctp.so.1libdl.so.2libtalloc.so.2raiselibpthread.so.0libc.so.6ld-linux.so.3_edata__bss_start__bss_start____bss_end____end___endlibosmovty.so.13/usr/local/jenkins-build/inst-osmo-bts-sysmo/libGLIBC_2.4GLIBC_2.7TALLOC_2.0.2LIBOSMOCORE_1.0GLIBC_2.12b ii X0ii ii 3 "  q# Hii            dlt<@Ddhlpt 48<\`d$(,LPTtx|<@Ddhl ,04TX\| $DLH @DHhlp 048X\` $,4<DLT\dlt|(,0PTXx|   @ D H h l p      ! !!0!4!8!X!\!`!!!!!!!!!!" "$"("H"L"P"p"t"x""""""""""###8#<#@#`#d#h##########$$$,$|$$$$$$$$$$$$% %$%D%H%L%l%p%t%%%%%%%%%% &&&4&8&<&\&`&d&&&&&&&&&&&''$'(','L'P'T't'x'|''''''''''(((<(@(D(d(h(l((((() ))0)4)8)X)\)`))))))))))))* *$*(*H*L*P*t*******+++<+@+D+d+h+l+5WVL 002 ;$S(<,0T4H8M<@PDHLZPgT%Xw\Y`dPhlpt3x| ; $( ,,064 8 < @DH LPT'X(\`dMhlQptx.| - !8"#$:%X&'()*+,7 -./F 1$3(4,054&86<7@/D8H9L:P T=X>\@`d?h@lpAtBxC|D9EFGHIJKLNNOPQR#STUVRW X2Y[\ ]^_`a b$c(d,e0f4h8<@iDjHkLlPmTnXo\p`qdrhsltputvx"|xyz{|}~\?Z   $(,048<@DHLPTX\`dhlptx|4!$*@-O-XƏ,ʌXƏ,ʌPƏ,ʌHƏ,ʌ@Ə,ʌ8Ə,ʌ0Ə,ʌ(Ə,ʌ Ə,ʌƏ,ʌƏ,ʌƏ,ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌxƏ+ʌpƏ+ʌhƏ+ʌ`Ə+ʌXƏ+ʌPƏ+ʌHƏ+ʌ@Ə+ʌ8Ə+ʌ0Ə+ʌ(Ə+ʌ Ə+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌƏ+ʌhTT! A- M A0.!p@`^PS^ Ѝ. S@p`P Q  S 0 0\@SZS^ Q  Q Sp ppp0 ` ```0 P PPP0 wH6D6p=D4@= D?<C?<C?0 0 R/@404000CS 00/ 0S//88AA(00/ 0S//84L0L 00 S/80@-0S (00 0 Tȶ880 0R 0S @-3/@ꨯx` p@- P U@@``PU PpP LU%P20Sp@- @%  0 BSx0x 0 `P @PT  B0 @0CTP00p,02o/p@-`P $PP@T000p1@-@ @l1G-`RPp  @DT@!   T0`V00 U@ 0@S  5PP 0@SPP0P0P1- M0c  Ѝp@-P@  p@0SS A-@M p@ P TP`  RࠃL^ @TЍ0P{@P! P  `0LT`*P  0LS0@S @D00 TЍ0S SЍ@@//G-`V PwPp @V`0Y0S p0@-\ M@P S Ѝ0 CA 00P0 R R QP/0dS0oSo//X0X0 \ 0S00 R  /0S00d0S00/00/0 0 /ራd 0 0  (/`d@-@0 00 +B 0R 0S  0XS000  0G-ASP@E S@ 10 # 0!S ! 1`0 R lqllp @01@S 0S 3/P 0S  0 R 0 S  000`0 R p弐开p @0 R01@S R 0S 2/P 0S  ꄪlcH,Hc$,3p|3+cbl++L+2+4b 0-S4M X00P(0$0 00000 0000 4Ѝ 00`a0*)O-r0M`@p. R "  0z2R00 0圲圢園0CPS  .\0  \  ]U 00CSU1 0"S kJ20 S (P   R. P . PU 1 SPURD 7 0l!S 4`T1TaTT p` P001P^0 R. \   UR  0 S  ЍOЍ    \ 0 S  `,,H)``)(x++d(_4+x((*dx*_'l'^*X^L^$''$^)@-!0@-gQ lQ aQ0 00@-P@00 M R P |t 00R P00Lz Ѝ04,00$4d\(\0(%x%e|2|"0p@-P@ R 0Sk T20PS$0SI  R 0St 20D R 0Se 108 0S 0!S K ,$0S 0!S <   R 0S/ 10|, R> 0S, X10Tp R 0S$ (10$ R 0S 100000   0000000000(0S 0 S  Xd(\(['['['`[',['Z'Z&Z&\#P#D#8#,# ###"Y"&0p@-@TT P`0\ P 0 0 4,00pp %%808 0@-@,(P {,负d%P0P 0@-@ P 8j0P 0 bhdP%@%000 0@-@P Pd%p@-D@D @P`,P ,>$ 0,p踞d$O-@dM@pc3`0#P 0P h T# P < P%3  0P0 2 `0 R0 R01@S 0S 3/P 0 R P 0SI P P- i0PadЍ P9P 0 00vh X00 e, zv000 R gcw00AV R0020l E0@t$X$L$L$dP$D$P$p##4#,###l"d"@"8"!!$! 0 0p@-P@P @p@pO-bPP` P@0"0CSWUTSPPONMLKJIHGFEDCBA@?>=8;6P1!0 Pj 币0 &`lpt;" AROEMLK7-HGFEDCBA@?>=<;:987653g ` 0U `p0I C R0 C[0H C[00,0< 0 )0Pܙ x l X--M0 0Ѝ Ѝ/O-,M@= 0ă  ;/ 0 $0S= 0  ;/x300P`Ph3hs00`3p0 0T3@00P@ T $00340 P ;/ Rh  @;/ T  ;/  ;/000圂20020 00S+*0 0q R @0Q@U ` 0P ;/  R00000S:  ;/ ;/,ЍaQ `P;/`(Pq ;/\  ;/L100@10 0414A00,1P0 0 1@0$0 0p0 W P 00i 0PE ` ;/ sU 0$0 .S ;/  ;/W|  ;/xЖd4hL8`$@`<@-@ @- 0 00`dA-pPP U@" P` *P PT  P VQ G-PML p` @T/TF .T P @T/T% .T @0 Ѝ PW 0. CRS' p ER  TPW0 S  E/S@T WP0 @T @  Ѝ P  - P O-P M7 p` @T1 .T - P @T# .T @0  Ѝ PY0.S S  ER  P0pS  E Ѝ P W @-@ 0S  $00 ; 00G`0@-@0@0 M PR% P0 0R00 00 Ѝ0`00X0 0 L L0 8080(jꌎd8G(8 --M0 0Ѝ Ѝ/H0H 0@- @0 0 $Xd$3O-0M03 0`00R Q2貟00 @㜐pW$00 00S N ^ \ nA 0S   R ^\c 2 0  00` p0 0\K 0H R CYI X_ 1@ 0, Y>  1^ 0, \!0-0 0.>#$  2#   R.  @0 S00 0R    0, 0)`0SЍ 0 S 00|  t00l0! 0, @|L0. 0, pd0t` pЦx  CCt 0 @-0@PP 00P0 P0P0( P0\P P0x@LP0P0 P0P脉tD4,O-4Ml0X00 @9/P  9/@  9/0 9/ 3 #0000 R2 P p0P R$0aV 0S0S @  0 (0@S0 |P X   8  9/00 Rm "P , "  "  ! ! ( ! $ 0qaWO  RK UW @0S P V $ 9/XI  ( 9/` 9/0  9/0S @ P` 0 0@S0QP[  0@S P  9/0P0 Rt 9/4Ѝ@ , 9/0S<dp|Dp 40 S00R@-M ,  (@@Ѝ  =,A-QR@P  0!S  t@R`) L000 0 0,!S $! @! 1p P 0@ @0i 008S 0 S  @et0p P xg0P 0 \_<00@?ꈄp=`=XdT|<XXHA-QR@P  0!S  t-@R`) 000 0 0,!S $! @! 1pP 0@@0008S 0 S  @t0pP x0P0 \<00@ꬂ; 8;| d :|   p@-P`p@ @ 00   0p S h  d0pL0`P <0000pĀ9T dX A-`P Pp@PE0S@ P T @-0   V414!0O-@`$M MpP/ 1A0P 0 P 0 S43 0 S4# 0 S 0 0;0ڍ Ѝ 0 S H00D(ڍ Ѝ(00d,8$|7 8@-@P  0< S  0  007L 0 0A- `@ @XPU@T`p0-T_T  00#1@@PT >Xp%T0SP00}pD0D 0p@-@P00[Up00p@S|d4 ( O-鸠R )Pq@`tW`V t0t 0 ] `pP ` @ _Yp00`l|p@-@ uPP 0S 00 empx0x0 X 0ST0T T0 L<0< <0 Cl4X=x34=T0 0G-0 RĠĀ `p01S P  0Q @Q01@S  0S  1C!0 Q0` Rzp@(O-0pQA00P@ Mm ` 0P S SWQ` S S ЍW T1 F 0SB 0!S? [0a p  S& "63 0@-  00 R60#60D c n d0P @   S S S0 ЍSy$P- M  Ѝp@-PPp @`R`@ 01@S f Rp@L 0 00001/wpp@-`@P`. P!P0|SU0 0 P \ @|R T00T 00p,00 0 PpvlQ- M Q  00   A Ѝ0 .}5O-04M 05,0001SV ,0`pV P@PE0P dP. @T,@0@`T f0P 0t(p4P0 040$04004000(  S @[S (S0 @)S |SY 0@('  )0  $ S(0, 0^ A 0S \ 00S 0S 0[S  ^,04Ѝ(S R 00 BP6&Q0#50|R00 @0 |S)S& " S 730  D P0"Q T $ 0[0 00 ]  0 V  0  k S S 0  S P U`0 S73PF0   0 Y0* Y/   037UP`  000]S |S1  @(2(P0@0,` ( Y (0|S  @(,0@0 0  0 P @0T0X XXX0 up$hh HH  00 0p@-@`o@0` 00P0P(Px<0Tp(0p@totsD4,@-@d@` 00 0`O-0M@Q0W PpPQ`-VQ 0-SK   0`VB@-P< PK U9 *0P `E@P-  00SP$ >P `@ V  0` 0 0F`P   00SYYP!P3UO Ѝ  _0Y@`P PF U 0P EQ@P  A00SP`>P @ Y 0 0 0I3`P   #00S[00Pe[PPUTT@@$O-$M\H`  2" 0 (0!`F 000! Q / 00Q p@ !R P [R` V'-Q 7 AB<RQ Pp@T:WT 000 S0:@P AB<RQp P P@X  $Ѝ AB<RQ  PZ xP#p vP X PP` 0  00  00@ @k4S\1A-0P`p@ [T1 .T@ <T% $5P7 /P7 A@DT@o PP @ W @@P@x 0ePP  0P@|W@yW@hO-M^@ P1p0 X-*0!0 ! R  @P0 `\T @ 0 P@ lPUP1 T:Z9 0X:UC ^- 00! R!  \ # '*0 `\( @ 0 P 9P"@ T:Z 0X:Ѝ00 00000 00PЍşO- 01 Z$@ * TP0C>01 Z@:0P0[S .S0 A C<SR00[S \0C. ! @u0  0 Z* TC>01 Z@:`  `04(, 0$_pTO-P\ 0S/ 0C 0/ h R/0@-00S@ S R000S S 0p@-S@  0S|01,`P $P Pp@|0 S/S00!, R/|0$0( 0@-SM@ 0   $0 R0$000  .Ѝ0 ( 0|00@-  [@P 000 P \  LP ,0( 0 }@(<0S/ @o/O-M M`10pP  0 @ Eۍ Ѝ 0 ` P@:[ `PU@TPP 0 0 pP@ۍ Ѝ   W (;`D--M0 0Ѝ Ѝ/T0T 00@- cM00P@T [ cߍ0 A@9d$0A-|ASP@( S`C0C@F$0 $0 006Vq@ppV 0@0  BV 0 S  0Sʤ 0@ 4/ 0S0 0\\  0 00 0 VP9|d4@-@l00@ R/@-@ R000S S  R000S SO-p@0M.SpRP 0R ! | 0 0 =ЍX!  H!  P 01`0 0$100100U *U@ 0 R s R @T 0S' 000`0 ЍO @ $ 0 S 0 0Tp  @p`000|P(8HG-`唀pP @`p T T 0@1,0S  0S00 T\ 0 @蜾O-` M` 0S! p吰吠吐吀Pp @ 0!R@ R  \   0S Ѝ@P$< 0!S0@- M@x! tmh100S 0/T!S EH_<10PU ,P&100S R1    D 0 S  : Ѝ0 S  .000S 0S 00 l  d  \00ꄵHO@O?ش, h>< 8, 0@-S $ }  l@-MP@ 0 0C@S@0_<e>h0e,`\ n2nAa?@G1c4 0B(e1LЍ艈ų*E.Œ//$00 R   /XL,  0S0S0 /(LA- pP 00`(@`xP0S Th00PP @{00(Ar00Kt`1!0O-@M00M PRY 0SI100H00 R x@,P: ``PB PPP1@0z 0 P X T 0Q00A  0S 0 0  hڍЍ00( R |ڍЍd  0X S P  LڍЍ0SQ 0S R0S 0S+ S 0A~Sa"Z#RPONYKkIHlEDCBA@?>=<;:9876543210/.-,+*)('&%$#p!      ] 0S[aʐ0S   ߍ 0S $0R0S Q Q*0 0 000S00 0R03 0S 0•0QQ qQ QL 0S= 0bQ AfQ/ Q{ dQ 0$  QfR`000S S  R00000S S  R 0 S  0$ S 0 S 0$ SQ; [Q00_ AAQ62.*0S R RS  j00o00I Q :RY0S S4?;x|0S0C0!, R |0Q$0S RS2 0`PSgd 0(S ( 0S S S 0S 0 00[&. "R[R00   00?/ 0(S (  $0``PU U APP 0 P @P񏐘 0S G( $  0L'S D' @ 0S0|000 6 0 60 0S|0S0C0!, Rg |0cv_[mW00S PPO !$ 000S0 0 \ #`E 0%S % X\00CS93(65/00" 0A^S 0x%S p% l5 0S `$ ( M0S 0S 6V3 0$ |0P0 $ 000S0 0 \  0$S $ \0S S 00,0S 0, `0!P `(@`@0p0S pW .W@T@1U `P #0p 0 #$@ (@4 #0 $8 #0C0C (0< 3#0 HLTp@ DP,p`aV Y  2P ` pW t(0P 0.YS408  p 0$ 0pPU: 0DSHLPTp PU R(0P 00 .R 0Rp" l P$ hI\ 0S0 $0 40$0S# PU0E01,Q `P|P P1P JP P+ Q R0  0`| 00 0T!S L! H 0SU V  0!S !  0S   0 S   - 4\pD|(<L̢l8@Tp$4*L8LdL@x@@ R x0P,` `$@( @R < LT $0R(  } 0SvZtHwR 0SeIc c>&G00=1  0 Q `P 00S0 UK 0"S " $000`00 0\"S d"  0SE 0 S 0 20 R00 `V000 0`SPS2. 0R0 @# D000( $pLk 0.YS30 <p;# # O@0@,` 0#S # ( $VD 0.S 0 S,4006@40QA-`P P0p0` p`@04PPU U Ut0 ` aP@0 (0 (h`A-HM @`< Pp{ m02 00S 20P` @d"p 0S000P( P PLP $P,G1|P0P 0PS0೨0100S 0SF l100S 0S9 P10L0 88QHpP0@0' 0 0 0 00 0 0S   HЍt px000S 0` S X  T00 @2d211HЖ̹00P//,0000S/$ A-`p`0p RP 0APT 됀0 RX0P0 R@` 0!R a0@ R/ $0 00/P\ @o/@-00.d"O- M@ HH2 P@2@"0082 0 0p$` .2"0 10m100@ GR1 !.0^R@@P T 0R10T A0BSH W P@@ T 0 R010@ @ Tp!W` 0@ @(PPyxvspmjF g dZ ЍO_<0 0괺0 dd(-<p@-@<PJ`P @p@ꄑ0 0p@-`| P P@P U\ P0P 0CPP p y@ȹolkh$@-@d@_`T0 0A-p P @P  0 `\ a0 P0    @7иԸA-lpl`@pP`PP!0 !1U*謸@\  0S0Q 0\ //p@-P`d@ 0Ta0"0%pp@-P@` 0Ta0"0%p0S0/p@-P@0p0S/0 S011/Q/ 0CA\/ 02AS/0S0C0/Q/ R 0 Q S/ O-P4M@   Rb!؃ؤ D(< a@0 x4Ѝ  | 0\00S 0-S0 M Q 4,X Ѝ/@е0 \/p@- `MP 0x@9 R \2 0L S @)4 Ѝp  hT|4,0 \/p@- `MP 0x@ R \ 0L S @4  Ѝp  ꔴ0X@-MP@pr`0S 0P00S  0 S0 8 0Ѝ   @-c0 `D @-k0 0p O-P$M @ `p@PP  x4x0 0p4 00d4 00X400P4000S %VP T [hZ -Z@o 0 Q 0J! @ %JKZ xjRI7-PP`"``0 0  @PPr 0Sl20 $ЍؠPPU$0PPM0PPEРPP=ءPP5آPP-أ PP%ؤ PP% PP 0  0  |0 00 0 |dԲвp̑<ĉ0į̮ p̏`D@- M@^ 00  80<( Ѝ̻ĭ|0-M  0Ѝ0@- M@^ 00  80( Ѝ0n @-\M 0 T00 LD 58  , Ѝ00ꈺX00! O- 4Mp`<0 `@P@L p@@0SP!p s0P80 c !0 PXT00(0 @p pD1H@ 0D0 0S0<S= 40 `0   M0Q,0 @40,0 010 Y U00 Y,0@ [ <  8(D  rP (0W0(0 0pG`0S0 S L0( B8 0L H@ V80@00D8 KH@800@00Dꘫ0A-p`SMNP\!p LAL8@ #8 0 P0 1p0 @PR' @PЍ0 @0h@X0 ЍR P 0 0l T0 h0h`0X@K@D0D`0TA4 4L(Ȩب̨lC-M0 p0" tb`PP6(@ pT20SO YP=,2,"0 0n20 @ 0P 50P@10 @ 0@PP(PF Ѝ10 R4 (P x1 0 l!0 ЍYD1 08!0 rP1@0 PZЍ@@00@@ R P>P0 00P0 9d0d0HDXD <\Ȧԥlp@-`@P p(0P000p0(00x pp0  A-pP@`Z 0AA-Mp Pp@a!`000S+ tP,P S, 0 ЍXڀ0 0t 0 P T0Tp0 8pp0pp   pL0L 00S ( P( R 0S// \/0@-PM0@  @ 0 U T T T Ѝ0000000 h0h 0p@-PP@ T@4@@J 0 0p@5|d 0@-S  $00 00@8x 0( S@-   w 0( S@-   踮wp@-88@P Ppp@Xp@-t@R@@PXP dOp 0S 000, Bp00Ԗvp@-@P7P C.p 0S ,00( !p 00h<$v@-`R`` M@ppPP 0P0 Ѝx0 p0 0 BPP w 0S <008 k00ĕdy|Hup@- @PUP ;`P L0`0p 0S ,00( ;p 00̫tA-p`P+@P XڔP 0@0@P  0S 000, 00Ġ4sO-阦QMw6 0$0 0S! p& ( d& , \& 0 T& 4 L& 8 D& < 40S$0XJQߍ80%S % 0SD50  0 S 50( 5p0S  3/ 01 S l50, 0M SL500 1 0""S $504 1 0"!S 408 |10  0$S $  oL0S 0$S $  bP< T0S 40 Qph O0Q 0Sx @4@0 04400,400$40040040 0  / 0S 0 0& @0TQ* ’@P\  ,`#0 P R d 0  0@ S8304 >$ 0S } 30 1@0< S 0 Su20 #@0S 0p "S "  <t 0S U20| l20 0R ,P20L @<X420*,20$20201 P @@) 0S 10  @1001010 00 S 10 z,1010v10x10p10h10`!S X! T ^S<108 U(10XԠT$rȟtr(rrqqqPPqd\q,xxȧp8oolop4o onnxl`Tmt|ĤxPm@mTmA-M@pP `1V0U- p00 0SPPPЍ 0 S 00Ѝ0 @00p@t0 Ѝ`00 0 S H00DЍ,00@jġjp@-@T `PP X 00op 0( S  ph i@-@P  00 S  $o  ꜠ĘXi@-@bP  00 S  $Q  $hhp@-@DdPPP T0@0@p 08 S  ,-p  |Php@-P`@@P x0 000@P 0@0p 08 S  ,|p  4dԞXg@-@ 00@$ @-@@PA-P`pW@P VڄVP ,0@0B/@P 0, S $  -hxf8G-P&P* 8p 0S` 00 Vڨ娐娀 @ 0@S 0 0 |VT00 0H S  <k$  $eePHeO-|M\ U d1d00\1`00P100D1p0081 00@0T   03P% 0 P *@ T)*0R"R  P 0T   0EP \ 0 P 8@ T:Ѝ(  (ԓtg 0DglԓA- MP p`0AS@P0SUP/ P2 xl1 0 0 gP+ D P< (   0Ѝ00P0000  0  0 @0l0 ,Hl``4<ܐkVkW@-@T P@_ 0( S  F`@-@P 08@0D0p@-P,@T 0X S P  H&pP, ,pp|X`P0S @-@,0S 0/ 0$ S   ,0_ЖАO-`$Mv8" pP ,200PX 0S r 2010! ! m10 Qe  0!S ! P1 1嘱001 001@00x10002S ,0焠 \ 0 P @T:0    0S 00}0S  3/$Ѝ0000|t00$ЍXdXL X^X^Tȏď$Дp]d]X]@-@`P .p@-@PNP ppA-@<00`P | P0 R@p 02 S ,0p儀0@ R~HA-@`vPpPUoP) ,0 p p_ 0 S l00h 0 S D00@,00$00>(ZZp@-@P4P +p(pp@-@P`#@P @Up pp@-@P@P lppp@-@P@P Dppp@-@Pv@P ppp@-@Pa@P pppp@-@PL@P ppp@-@P7@P wppp@-@P"@P U|pypp@-@Pu @P gpdpp@-@P``P p(@,@RpOpx p@- P(@P \ P P0 0  p@Z( ((G> ܈Ԉ\|`@-E M@ZXVBTRVP NjLJ~H"FD'B4$*0 x4x$ m0 0.1,*(6&$(0<00s3 TSP3SP QP J3 0 0 P # 9P # 0P d)P L"@X4,CS @#3; 3%BVj~"1 6B~E{GwJtpOmQifVbY_[[^XT Ѝt1t0PQL1P0M,14!00 PU0 !0 PR00N 0  J> yl00=LX,\H؇ćP\|u,H$ԕrԄ[t[@-^H0-R M00 0P Ѝ4@-@-p@-0@`xP  0 R T 0D S <  8,0 pOx0A-PM@0a`p 0P`SZ t10p  0SM T10P  0S@ 41000 0 0!S !  0 S   0 S    0 S  Ѝt00l00d00ȏLQ$$ЅNN\NȜdD NMMM@-`MPp@0P 0S` h00d 000OHW<S0OЍ00(Lp@-`MP@ t0 0`P0R \  X 0 0<%0!Ѝp  ̌`4LLKA-pMP@0`p0V 00 P QP   0 0@`TH<Ѝ$܋lJ0@-` M@R0PN 0SpM <108  0S@ 100 0 0 S   0 S   0 S   % 0 S  pxtt Ѝ\00T00ꄁ\x0 JXIHI<I\\Rp@-P@P pT 0S H00D pP@@00u`~D>Rp@-P@P gpT 0S H00D p{P@@00t~=<p@-@PY$U00 6p\}R@-  ^}@-@ 0S 0 VP P`ǿ 0S  4000200,4Gsh<p@-@MP V0 'P P`5/PЍp`╿ R0 <  8  Ѝp  pxLFr@;$$0 0 0 0ꌹP{ 0 00PPȎ 0 00  0 00 0  0 00괸 L@-@ MP i0 ి`V P p35/P Ѝ` R0 <  8   Ѝ  ꔍpDpP9$$0 0 0 0ꜷLX@ 0 00`L 0 00,h،0@-S 0 P@P P` 0S  000,,00BoTP80@-S 0 $@P 7P`╾ 0S  000,00dl@Bn̋7@-@ٿ0S 0 P SP`d 0S  4000Ͼ00X|An06Rp@-PP@ᴿ0P  0 pۿ0P (  0$ S   ाptmP6Rp@-PP@ᐿ0P  0 p 0P (  0$ S   pl58p@-@A@Q@0(.Px  F P0pZn# -߽ܽ2ٽ7ҽp@νx<<dO-$M@p߽ 0Pj S d 100SN !帱  !尡  !0  !  0 0 P 0QP 0@`@ T  40  Q @ 0ս T 0 S  ɽ 0 S 0 0 0 0 S  ල$Ѝx00S  d00`৽$ЍH00$k3j3xjj2Si2|t2xiȒ82O-@M,pP埽 0SV 10  0{0PUM  R ddd P`0 PQ    _ R 0R'    P0S ذؠؐP `  P0   70`SPЍp  h00 0S T00P  <00ht1h$ht0g\h0\0`gt$0 ZHp<0< 0p@-P@T `B@Tpp@-P@ᱼP 2p 0 S $00 p 00\f / 0G-S`0MPp X x  ż2@ 0SC @10<  0᳼ 0S R= !   ᥼L0S P@ 0S( 00  0ᒼT@V\@D 堐堀  0R    ~\@V\@DЍT00LD00<  ee|xel0e,-d -|-p-d- mX0X 0A-pW `P@T x@TpW$p@-@`PP @U a@Up 0 S $00 "p 00dc(,p@-H@@0Sp8PP˻(ɻPǻxŻû00p G-M@8PcT `p& R 0S S*XA 0 S |100tt1p0߻ЍX100R0! R0Y"X > ᦺTP Z8  0S- 000 0රЍ0 P@  ჺP Ѻ 0 S p000hh0  p0D00<004  hbk+(ka(@aԏpj))Pp@-@M` Pᆼ00P 000 P0fS  bS   X0`0߻Ѝp<޹PP$B0P꘏dXDA-0M`0 P p^ ػ@P 0` S  T+@0Ѝ8  0 0 P}0Ѝ_xD(p@-0MP` 0 2 `0Ѝpp@-0M0 @ P#l P 0P S H  D0Ѝp0 @0i0Ѝp̍^x'@-@@ᔺ(ⒺP@菺 00/p@- M P`_A!@0@ R5 eP l ݻp` Ѝp@T; TP'1 00R  10Ѝp0 0 0 㛹0000ꁺ@0 0 0  ္q`\0` 0HH̹Ԥ<8]\%`@p@-P`P@`TM ЍpS^P00PU P 6幹l0l 00@h0 6&婹40 0h$ܾԏ\00 SL@-x00@\@0?J@`Prq7( 00 S000ΕW00΅\@%JR21 3000Rrq700Rrq700RS000T\ZT 000/O-JMMm 0S p20 @h  ᩹X"<0 dᴹPy 0200(200 200200(0 0 PO 0.S  0 d`ᐹp@B (p *P  J.0@0x$S R x$C J>0x4@}@@몹P@BA z -0P⠰ n 0 S0 0 @ ˹P@ YJލЍ0 p(0꠰ $0$0P0͵d00t 0S P00L JލЍ,00Y "$YD HW O-M MPp @a`P00͵X 10 Rg 㜹P <@ݍ Ѝ1 0!1 ꏸl!$@ d0JPJ D1D00<1<0041@0 0I 0P  0.S N00 R@ XP  p@Όݍ Ѝ 0 0 p@ 0 㣷0 L0L0 @꼝`0Zkĉ̈O-@`M0aQp00lS0lS0SR    0&S & PЍնP P  \ 00P[X 0S H60D +Ѝ0G?o2000jP RQP@00S!  / [;: @ @$ppY00G0 S01aCQW0C0 U  U U 0U031 T @$pW[ 0 pTɷL R0 |$ x  ᵷԷT40}W00p `4$< d0ᲷPf 4d00(0 0 !P 0.S  & 0 ᖷ$p  10Pᐸ P ᐸ90SS``e@c`5 p[`V`  P 0 2L m T2"X @ ` F2 00 TLPP ``勵 0 (⋶PP؂?YXW2W00000 0S 10 Ѝ"10 0S 10 00xS0h10꛶\!< d0 VP b 0P 0.S g0S   @ xR QxPB xP@ 0@0P8ȷ ̷00x  000Tȉ8SȈQ؇lT PвLN\NDL1O-00AM MRP@T0 0T!S KHq<100 R 0SA 10b 100@T. 0p0 0 p`T 0R  S 00 0?0@000T P L&P+ 8AލЍH  @00̯(tdL8ЂlULhK@A-PP`V! ( pԶ@@0 p 0㠵`(|㙵㖵⩵( (((0 ԁ,X~0x[G-pRpbP@`TBM? p⧴ ⛴ P@UH 0S :SX @TYi P0L pP< 1 Bލ@T!? વ $P@Th10 R 8PP D1D!00@81 PᐴP10P @P L_P0 0͵00`V P0 c0 0 0  c0 PPӴl0@0 TX଴P0$l8}d1X|~|4T|{1!O-0 M @  OPC d0X! R, Q) C S>C S=C  S=C S%s %s %s %s %s %scommand.c:757 %s %scommand.c:782command.c:783 %s %scommand.c:790Shutdown requested from telnet command.c%s is shutting down. Bye!%s%s has been running for %s%s %s %s %s%s%s %s Common Commands%s These commands are available on all VTY nodes. They are listed here only once, to unclutter the VTY reference.%s %s%s string)cmd_make_descvecA.B.C.Dcommand.c:1928command.c:1662A.B.C.D/Mcommand.c:2338complete-lcdstrcommand.c:2389struct vty_parent_nodecommand.c:2689command.c:2884command.c:2953command.c:2977command.c:2991../../include/osmocom/core/utils.h:127Configuration is not consistent%sCan't save to configuration file, using vtysh.%sCan't open configuration file %s.%sCan't unlink backup configuration file %s.%sCan't backup old configuration file %s.%sCan't unlink configuration file %s.%sCan't save configuration file %s.%sCan't chmod configuration file %s: %s (%d).%sConfiguration saved to %s%scommand.c:3552command.c:4381command.c:4402cmd_lib_attr_letters[i] != rafc[j]cmd_lib_attr_letters[i] >= 'A'cmd_lib_attr_letters[i] <= 'Z'cmd_lib_attr_letters[i] != cmd_lib_attr_letters[j]no banner motdNegate a command or set its defaults Set banner string Strings for motd banner motd defaultSet banner string Strings for motd Default string banner motd file [FILE]Set banner Banner for motd Banner from a file Filename echo .MESSAGEEcho a message back to the vty The message to echo no service terminal-length [<0-512>]Negate a command or set its defaults Set up miscellaneous service System wide terminal length configuration Number of lines of VTY (0 means no line control) service terminal-length <0-512>Set up miscellaneous service System wide terminal length configuration Number of lines of VTY (0 means no line control) terminal no lengthSet terminal line parameters Negate a command or set its defaults Set number of lines on a screen terminal length <0-512>Set terminal line parameters Set number of lines on a screen Number of lines on screen (0 for no pausing) no enable passwordNegate a command or set its defaults Modify enable password parameters Assign the privileged level password enable password LINEModify enable password parameters Assign the privileged level password The UNENCRYPTED (cleartext) 'enable' password enable password (8|) WORDModify enable password parameters Assign the privileged level password Specifies a HIDDEN password will follow dummy string The HIDDEN 'enable' password string password LINEAssign the terminal connection password The UNENCRYPTED (cleartext) line password password (8|) WORDAssign the terminal connection password Specifies a HIDDEN password will follow dummy string The HIDDEN line password string no hostname [HOSTNAME]Negate a command or set its defaults Reset system's network name Host name of this router hostname WORDSet system's network name This system's network name show startup-configShow running system information Contentes of startup configuration show running-configShow running system information running configuration write terminalWrite running configuration to memory, network, or terminal Write to terminal copy running-config startup-configCopy configuration Copy running config to... Copy running config to startup config (same as write file) write memoryWrite running configuration to memory, network, or terminal Write configuration to the file (same as write file) writeWrite running configuration to memory, network, or terminal write file [PATH]Write running configuration to memory, network, or terminal Write to configuration file Set file path to store the config, or replace if already exists list [with-flags]Print command list Also print the VTY attribute flags show vty-attributes (application|library|global)Show running system information List of VTY attributes Application specific attributes only Library specific attributes only Global attributes only show vty-attributesShow running system information List of VTY attributes Description of the interactive help system show uptimeShow running system information Displays how long the program has been running show pidShow running system information Displays the process ID show online-helpShow running system information Online help show versionShow running system information Displays program version shutdownRequest a shutdown of the program endEnd current mode and change to enable mode.exitExit current mode and down to previous mode Turn off privileged mode command enable [expert-mode]Turn on privileged mode command Enable the expert mode (show hidden commands) configure [terminal]Configuration from vty interface Configuration terminal all commands except deprecated and hiddenall commands including hidden, excluding deprecatedhidden commands onlyexperthiddenThis command applies on IPA link establishmentThis command applies on E1 line updateThis command is deprecatedThis command is hidden (check expert mode)This command applies immediatelyThis command applies on VTY node exit%s(config)# %s# Password: %s> "vty.c:505vty.c:1671/usr/local/etcchdir failedgetcwd failedsave_cwdstruct vtyvty_new->bufvty.c:140vty.c:290vty.c:312 %-*s %s%sdescribe_foldvty.c:1154*%svty[%d] %sline vty%s no login%s login%s127.0.0.1 bind %s %d%s bind %s%s%dd %dh %dm %dsvty.c:237vty.c:249vty.c:257Welcome to the %s VTY interface%s%sMOTD file not found%sRFC 1073 violation detected: telnet NAWS option should send %d characters, but we received %lu[2J%c%s%c%s[H%% Bad passwords, too many failures!%s%% Bad enable passwords, too many failures!%sWarning...%s%% Ambiguous command.%s%% Unknown command.%s%% Command incomplete.%svty.c:605vty.c:1085vty.c:1092%-10s vty.c:1099%% There is no matched command.%s %-s%sAmbiguous command. There is no such command. Inconsistent indentation -- leading whitespace must match adjacent lines, and indentation must reflect child node levels. A mix of tabs and spaces is allowed, but their sequence must not change within a child block. Error occurred during reading the below line: %s Vty password is not set.%s%sUser Access Verification%s%svty_vectorvty_commandAttribute flag character '%c' is reserved for globals! Please fix. Attribute flag letter '%c' is reserved for libraries! Please fix. Found duplicate flag letter '%c' in application specific attributes (index %u vs %u)! Please fix. %s(config-line)# show historyShow running system information Display the session command history terminal no monitorSet terminal line parameters Negate a command or set its defaults Copy debug output to the current terminal line terminal monitorSet terminal line parameters Copy debug output to the current terminal line no service advanced-vtyNegate a command or set its defaults Set up miscellaneous service Enable advanced mode vty interface service advanced-vtySet up miscellaneous service Enable advanced mode vty interface bind A.B.C.D [<0-65535>]Accept VTY telnet connections on local interface Local interface IP address (default: 127.0.0.1) Local TCP port number no loginNegate a command or set its defaults Enable password checking loginEnable password checking line vtyConfigure a terminal line Virtual terminal whoDisplay who is on vty struct _vectorvector_init:indexvector.c:52vector.c:60vector.c:65vector.c:70vector.c:71vector_copy:indexvector.c:87vector.c:102 %s%s: %8llu (%llu/s %llu/m %llu/h %llu/d)%s %s%s: %8lu%s%s%s (%d)('%s') %s%s: %8i %s%sutils.cp >= fmt%c%*s%*lluutils.c:197%s%s:%s%sUngrouped counters:%sutils.c:386telnet_connectionCannot bind telnet at %s %d telnet_interface.cAvailable via telnet %s %d r=NULL<->l=NULLtelnet accept failed Accept()ed new telnet connection %s struct telnet_connectiontelnet_interface.c:203couldn't create VTY telnet_interface.c:212Closing telnet connection %s telnet_interface.c:146telnet_interface.c:150telnet_interface.c:275gen_logging_level_cmd_strsgen_vty_logp_cmd_strs%% Ignoring deprecated '%s'%s%% systemd-journal logging is not available in this build of libosmocore%s%% Ignoring deprecated logging level 'everything' keyword%s %% Unable to find GSMTAP log target for %s%s%% No such log file '%s'%s%% Unable to create GSMTAP log for %s%s%% Unable to create osmo_strrb (size %u)%s%% Unable to create file '%s'%sblocking-io raw lastlog stderr%slog stderr blocking-io%slog syslog %s%slog file %s%slog file %s blocking-io%slog alarms %zu%slog gsmtap %s%slog systemd-journal%s%s logging filter all %u%s logging color %u%s logging print category-hex %d%s logging print category %d%s logging print thread-id %d%s logging print extended-timestamp 1%s logging timestamp %u%s logging print level 1%s logging print file %s%s%s%% Invalid log level %u for 'force-all'%s logging level force-all %s%s%% Invalid log level %u for %s%s logging level %s%% Invalid level '%s'%s%% Invalid category '%s'%slogging_vty.c%s %% vty->index_sub == NULL%slogging_vty.c:606%% No syslog target found%s%% No osmo_strrb target found%s%% No stderr logging active%s%% Unable to open syslog%s%% Unable to create stderr log%s%% No alarms, run 'log alarms <2-32700>'%s%% Showing %i alarms%s%% %s%s|cmd->string == NULLcmd->doc == NULLlogging level (Configure logging Set the log level for a specified category ) %svty_log_level_cmd_strvty_log_level_doc_strlogging_vty.c:627%% Logging already enabled.%s%% Logging was not enabled.%sOnOffEnabledDisabled Global Loglevel: %s%s Use color: %s, Print Timestamp: %s%s Log Level specific information:%s %-10s %-10s %-8s %s%s Log Filter 'ALL': %s%slogging_vty.c:508struct cmd_elementcmdlogging level %s (debug|info|notice|error|fatal)Set the log level for a specified category Deprecated Category Deprecated alias for 'no logging level force-all' everythinglogp (Print a message on all log outputs; useful for placing markers in test logs .LOGMESSAGEArbitrary message to log on given category and log level vty_logp_cmd_strvty_logp_doc_strno log alarmsNegate a command or set its defaults Configure logging sub-system Logging alarms to osmo_strrb log alarms <2-32700>Configure logging sub-system Logging alarms to osmo_strrb Maximum number of messages to log no log file FILENAMENegate a command or set its defaults Configure logging sub-system Logging to text file Filename log file FILENAME [blocking-io]Configure logging sub-system Logging to text file Filename Use blocking, synchronous I/O no log stderrNegate a command or set its defaults Configure logging sub-system Logging via STDERR of the process log stderr [blocking-io]Configure logging sub-system Logging via STDERR of the process Use blocking, synchronous I/O no log gsmtap [HOSTNAME]Negate a command or set its defaults Configure logging sub-system Logging via GSMTAP Host name to send the GSMTAP logging to (UDP port 4729) log gsmtap [HOSTNAME]Configure logging sub-system Logging via GSMTAP Host name to send the GSMTAP logging to (UDP port 4729) no log systemd-journalNegate a command or set its defaults Configure logging sub-system Logging to systemd-journal log systemd-journal [raw]Configure logging sub-system Logging to systemd-journal Offload rendering of the meta information (location, category) to systemd no log syslogNegate a command or set its defaults Configure logging sub-system Logging via syslog log syslog (authpriv|cron|daemon|ftp|lpr|mail|news|user|uucp)Configure logging sub-system Logging via syslog Security/authorization messages facility Clock daemon (cron/at) facility General system daemon facility Ftp daemon facility Line printer facility Mail facility News facility Generic facility UUCP facility authprivcrondaemonftplprmailnewsuseruucplocal 0local 1local 2local 3local 4local 5local 6local 7log syslog local <0-7>Configure logging sub-system Logging via syslog Syslog LOCAL facility Local facility number %s(config-log)# no descriptionNegate a command or set its defaults Remove description of the object description .TEXTSave human-readable description of the object Text until the end of the line show alarmsShow running system information Show current logging configuration Show the contents of the logging ringbuffer show logging vtyShow running system information Show current logging configuration Show current logging configuration for this vty logging disableConfigure logging Disables logging to this vty logging set log mask MASKConfigure logging Decide which categories to output. Log commands Mask commands 'set log mask' is deprecated, please refer to the docs of 'set-log-mask' instead logging set-log-mask MASKConfigure logging Set the logmask of this logging target List of logging categories to log, e.g. 'abc:mno:xyz'. Available log categories depend on the specific application, refer to the 'logging level' command. Optionally add individual log levels like 'abc,1:mno,3:xyz,5', where the level numbers are LOGL_DEBUG=1 LOGL_INFO=3 LOGL_NOTICE=5 LOGL_ERROR=7 LOGL_FATAL=8 logging level all everythingConfigure logging Set the log level for a specified category Deprecated alias for 'force-all' Deprecated alias for 'no logging level force-all' logging level all (debug|info|notice|error|fatal)Configure logging Set the log level for a specified category Deprecated alias for 'force-all' Log debug messages and higher levels Log informational messages and higher levels Log noticeable messages and higher levels Log error messages and higher levels Log only fatal messages no logging level force-allNegate a command or set its defaults Configure logging Set the log level for a specified category Release any globally forced log level set with 'logging level force-all ' logging level force-all (debug|info|notice|error|fatal)Configure logging Set the log level for a specified category Globally force all logging categories to a specific level. This is released by the 'no logging level force-all' command. Note: any 'logging level ' commands will have no visible effect after this, until the forced level is released. Log debug messages and higher levels Log informational messages and higher levels Log noticeable messages and higher levels Log error messages and higher levels Log only fatal messages logging level set-all (debug|info|notice|error|fatal)Configure logging Set the log level for a specified category Once-off set all categories to the given log level. There is no single command to take back these changes -- each category is set to the given level, period. Log debug messages and higher levels Log informational messages and higher levels Log noticeable messages and higher levels Log error messages and higher levels Log only fatal messages logging print file (0|1|basename) [last]Configure logging Log output settings Configure log message Don't prefix each log message Prefix each log message with the source file and line Prefix each log message with the source file's basename (strip leading paths) and line Log source file info at the end of a log line. If omitted, log source file info just before the log text. basenamelogging print level (0|1)Configure logging Log output settings Configure log message Don't prefix each log message Prefix each log message with the log level name logging print category-hex (0|1)Configure logging Log output settings Configure log message Don't prefix each log message Prefix each log message with category/subsystem nr in hex ('<000b>') logging print category (0|1)Configure logging Log output settings Configure log message Don't prefix each log message Prefix each log message with category/subsystem name logging print thread-id (0|1)Configure logging Log output settings Configure log message logging Thread ID Don't prefix each log message Prefix each log message with current Thread ID logging print extended-timestamp (0|1)Configure logging Log output settings Configure log message timestamping Don't prefix each log message Prefix each log message with current timestamp with YYYYMMDDhhmmssnnn logging timestamp (0|1)Configure logging Configure log message timestamping Don't prefix each log message Prefix each log message with current timestamp logging color (0|1)Configure logging Configure color-printing for log messages Don't use color for printing messages Use color for printing messages logging filter all (0|1)Configure logging Filter log messages Do you want to log all messages? Only print messages matched by other filters Bypass filter and print all messages logging enableConfigure logging Enables logging to this vty %s %u (%s)%25n: %10c (%S/s %M/m %H/h %D/d) %d// osmo_stat_item_group table %s%s.%s - %s%s[options="header"]%s|===%s| Name | Reference | Description | Unit%sstats_vty.c:572stats_vty.c:573| %s | <<%s_%s>> | %s%sstats_vty.c:500stats_vty.c:501stats_vty.c:502| %s | <> | %s%sstats_vty.c:465stats_vty.c:466| %s | <<%s_%s>> | %s | %s%sstats_vty.c:548stats_vty.c:549stats_vty.c:550stats_vty.c:551// rate_ctr_group table %s%s| Name | Reference | Description%sstats_vty.c:522stats_vty.c:523// autogenerated by show asciidoc counters%sThese counters and their description are based on %s %s (%s).%s%s=== Rate Counters%s%s// generating tables for rate_ctr_group%s=== Osmo Stat Items%s%s// generating tables for osmo_stat_items%s// there are no ungrouped osmo_counters%s=== Osmo Counters%s%s// generating tables for osmo_counters%s// ungrouped osmo_counters%s.ungrouped osmo counters%sstatsdlogstats interval %d%sstats-tcp interval %d%sstats-tcp batch-size %d%sstats reporter %s remote-ip %s%s remote-port %d%s local-ip %s%s mtu %d%s level %s%s prefix %s%s no prefix%s flush-period %d%s enable%s disable%s%% Unable to set interval: %s%s%% There is no such log reporter with name '%s'%s%% There is no such statsd reporter with name '%s'%sstats_vty.csrep%% Unable to set force flush period: %s%s%% Unable to set %s: %s%sprefix stringremote addresslocal addressmturemote port%% Unable to disable the reporter: %s%s%% Unable to enable the reporter: %s%s%% Unable to set level: %s%s%% Unable to create log reporter%s%% Unable to create statsd reporter%sstats resetStats related commands Reset all rate counter stats stats reportStats related commands Manurally trigger reporting of stats show rate-counters [skip-zero]Show running system information Show all rate counters Skip items with total count zero show asciidoc countersShow running system information Asciidoc generation Generate table of all registered counters show stats level (global|peer|subscriber) [skip-zero]Show running system information Show statistical values Set the maximum group level Show global groups only Show global and network peer related groups Show global, peer, and subscriber groups Skip items with total count zero show stats [skip-zero]Show running system information Show statistical values Skip items with total count zero stats-tcp batch-size <1-65535>Configure stats sub-system Set the number of tcp sockets that are processed per stats polling interval Number of sockets per interval stats-tcp interval <0-65535>Configure stats sub-system Set the tcp socket stats polling interval Interval in seconds (0 disables the polling interval) stats interval <0-65535>Configure stats sub-system Set the reporting interval Interval in seconds (0 disables the reporting interval) no stats reporter log [NAME]Negate a command or set its defaults Configure stats sub-system Configure a stats reporter Report to the logger Name of the reporter stats reporter log [NAME]Configure stats sub-system Configure a stats reporter Report to the logger Name of the reporter no stats reporter statsd [NAME]Negate a command or set its defaults Configure stats sub-system Configure a stats reporter Report to a STATSD server Name of the reporter stats reporter statsd [NAME]Configure stats sub-system Configure a stats reporter Report to a STATSD server Name of the reporter flush-period <0-65535>Configure stats sub-system Send all stats even if they have not changed (i.e. force the flush)every N-th reporting interval. Set to 0 to disable regular flush (default). 0 to disable regular flush (default), 1 to flush every time, 2 to flush every 2nd time, etc Disable the reporter Enable the reporter level (global|peer|subscriber)Set the maximum group level Report global groups only Report global and network peer related groups Report global, peer, and subscriber groups no prefixNegate a command or set its defaults Set the item name prefix prefix PREFIXSet the item name prefix The prefix string no mtuNegate a command or set its defaults Set the maximum packet size mtu <100-65535>Set the maximum packet size Size in byte remote-port <1-65535>Set the remote port to which we connect Remote port number remote-ip ADDRSet the remote IP address to which we connect IP Address no local-ipNegate a command or set its defaults Set the IP address to which we bind locally local-ip ADDRSet the IP address to which we bind locally IP Address globalpeersubscriber%s(config-stats)# Error: FSM with name '%s' doesn't exist!%sdigraph "%s" {%s "%s"; # out_state_mask=0x%08x%s "%s" -> "%s";%s}%s%sFSM Name: '%s', Log Subsys: '%s'%s%s Event %02u (0x%08x): '%s'%s%s No event names are defined for this FSM! Please fix!%s%s Number of States: %u%s%s State %-20s InEvtMask: 0x%08x, OutStateMask: 0x%08x%s%sFSM Instance Name: '%s', ID: '%s'%s%s Log-Level: '%s', State: '%s'%s%s Timer: %u%s%s Parent: '%s', Term-Event: '%s'%s%s Child: '%s'%sshow fsm-instances NAMEShow running system information Show information about finite state machine instances Display a list of all FSM instances of the named finite state machineshow fsm-instances allShow running system information Show information about finite state machine instances Display a list of all FSM instances of all finite state machineshow fsm-state-graph NAMEShow running system information Generate a state transition graph (using DOT language) FSM name show fsm NAMEShow running system information Show information about finite state machines Display information about a single named finite state machine show fsm allShow running system information Show information about finite state machines Display a list of all registered finite state machines full %*sreference to: %s%s%stalloc report on '%s' (total %6zu bytes in %3zu blocks)%s%*s%-30s contains %6zu bytes in %3zu blocks (ref %zu) %p%sappInvalid expression%s%pInvalid chunk address%sshow talloc-context (application|global|all) (full|brief|DEPTH) tree ADDRESSShow running system information Show talloc memory hierarchy Application's context Global context (OTC_GLOBAL) All contexts, if NULL-context tracking is enabled Display a full talloc memory hierarchy Display a brief talloc memory hierarchy Specify required maximal depth value Display only a specific memory chunk Chunk address (e.g. 0xdeadbeef) show talloc-context (application|global|all) (full|brief|DEPTH) filter REGEXPShow running system information Show talloc memory hierarchy Application's context Global context (OTC_GLOBAL) All contexts, if NULL-context tracking is enabled Display a full talloc memory hierarchy Display a brief talloc memory hierarchy Specify required maximal depth value Filter chunks using regular expression Regular expression show talloc-context (application|global|all) (full|brief|DEPTH)Show running system information Show talloc memory hierarchy Application's context Global context (OTC_GLOBAL) All contexts, if NULL-context tracking is enabled Display a full talloc memory hierarchy Display a brief talloc memory hierarchy Specify required maximal depth value Setting SCHED_RR priority %d cpu_sched_vty.cSetting SCHED_RR priority %d failed: %s %% Failed setting SCHED_RR priority %d%ssysconf(_SC_NPROCESSORS_CONF) failed: %s Thread list for PID %lu:%s/proc/%ld/task%% Failed opening dir%s%s/proc/%ld/task/%ld/comm TID: %lu, NAME: '%s', cpu-affinity: %s%sSetting CPU affinity mask for tid %lu to: %s self%% Failed parsing target thread %s%s%% It makes no sense to delay applying cpu-affinity on tid %lu%s%% It makes no sense to delay applying cpu-affinity on all threads%s%% Failed parsing CPU Affinity Mask %s%s%% Failed setting sched CPU Affinity Mask %s: %s%scpu_sched_vty.c:445struct cpu_affinity_it delaycpu-sched%s policy rr %d%sERROR cpu-affinity %s %s%s%s!sched_vty_optsstruct sched_vty_optsSetting cpu-affinity mask impossible: no opts! Setting cpu-affinity mask %s failed: %s show cpu-sched threadsShow running system information Show Sched section information Show information about running threads) cpu-schedConfigure CPU Scheduler related settingspolicy rr <1-32>Set the scheduling policy to use for the process Use the SCHED_RR real-time scheduling algorithm Set the SCHED_RR real-time priority cpu-affinity (self|all|<0-4294967295>|THREADNAME) CPUHEXMASK [delay]Set CPU affinity mask on a (group of) thread(s) Set CPU affinity mask on thread running the VTY Set CPU affinity mask on all process' threads Set CPU affinity mask on a thread with specified PID Set CPU affinity mask on a thread with specified thread name CPU affinity mask If set, delay applying the affinity mask now and let the app handle it at a later point %s(config-cpu-sched)# [(%% Error: no timers found%s%% Invalid T timer argument (should be 'T1234' or 'X1234'): '%s'%s%% No such timer: %c%u%s%% Timer %c%u value %lu is out of range %s%s%% Error: no such timer%s%c%u = %lu %s (default: %lu, range: %s%% Error: no such timers%s%s: %% Error: ambiguous timer group match%s%c%u %lu%stdef_vty.c!global_tdef_groups[TNNNN]show timerT- or X-timer-number -- 3GPP compliant timer number of the format '1234' or 'T1234' or 't1234'; Osmocom-specific timer number of the format: 'X1234' or 'x1234'. Show running system information Show timers [TNNNN] [(<0-2147483647>|default)]timerT- or X-timer-number -- 3GPP compliant timer number of the format '1234' or 'T1234' or 't1234'; Osmocom-specific timer number of the format: 'X1234' or 'x1234'. New timer value Set to default timer value Configure or show timers %stimer %s DYNAMIC][0[]ԯ@0| Tlt (08 (3HXb O (   o ( G\9o8oo5oOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOL`e\<Lȩ`eP HT0k@8cPX}$Xd8|P[ X,[ X H0[ T0[ X\ X ` k   đ X+J++!+ X((((<(+d8l(E(U(f({ (4(\((((($((L(Ct(@(s(W(l(P<(id(((((,(X  ( X   H\ \ X4] HD] D] X] XH] ,] X] B+X Q H] x] X<^ X  X+HH^ X^ H^ Xx_ H_ X_ H_ X_ H_ X` H` X|b Hb X++X0 |H  ( X@ HD D XX H\ \( X| H ( X H    0 !L 2D X$ H, @, X4 H< P<\ j X H( s( X H < X4 H8 8T l 4 , X H Xp H X H 0d X H  X H< <$ , `p C  X H U  Xl Hx b x X, HD m D X H8 Xt H| XD HX X H X H X H X H X\ H| X H X\ H X H X H X H X H X H X` H X X ~   X X+ + + + +X ( ( @( h( (+ (@ ([ (X 0(i X(X v H X H X H X H X H X H X H Xܹ  H j Xd Hp p X H  X H $ X J H XD HT T0 Xx H 0 X H 8 Xx  H  Xd  Ht  X  H  X4 HD X H XT X Hd d X H  X  d H  X H X H, X H X X+ +XX X, . H < L X H P @ X H( k ( ,@ X` Hl lL X H  X8 HH H X H  X H  XX Hd d X4 HD D X$ H&  &x X\' H'  ' X ( H( * (x X( H( < (x X) H ) N ) X) H) ` ) XP* Hd* p d*4 X* H* a *, X* H* * X+ H+ +, X, H, , XH. Hp. p.H X`0 H0 0t X1 H,1 XT1 HX1 X1 X1 H1 X@2 HL2  L2 X4 H5  5<  D5H - 5 X<6 HD6 C D6 X<7 HT7 Q T7@ k 7p X8 H8 } 8T X8T 8T 9T T9T 9T 9T P:T :X X: H: X|; H; X@ X )  8̼ F XTe(x(((((P(x(((2(I (_@ (}h ( ( ( (!(0!(X!(3!(_!(l!(!( "(H"(p"("("("(#(8#(4`#(J#(f#(#($(X X H8A 8A  XTA A HXA XA< XA A HA A XDB H\B \B$ XD AF( HD aD X8E HPE {PE XE HF X G H0G 0G XH HI I X$L HL L@ X(M H0M 0M X@Q H R  R| X|R HR R| XR HS #S XS HS =S XDT HTT ZTTL XT HT kT, XT HT vT XxU HU U XLV HdV dV< XV HV V4 XV HV V4 XV HW W4 X0W H)(W *(X rHj j j Xl Hl l Xm Hm mL Do Xq H r  rX X0t Hdt dt X{ H |  | X} H} X~ H~ X< X++-+XH*;H*(Ip*TT*(i*(+(X H  X0 Ht t XX Hx X, H\ X H Xh Ht X H  X H p X$ H, , X H X( H4 X HT X̎ X++X<+<+(d+(XP H؎  2X8X0H XDX R ^  n |؎   +؎ HO XO HO    0 $  Mk$(@\\ 2L D_$ Pe _ l ($T "$ .Mh0 ]+nH^t y  ^   4 + ` 1B04 S( eu0,(T  | 8 7 T s `$  P  DT T(  ,1, !&! A!Y!k!P u!! !\ _#<,!!+!""\@ /"$\ ="} U"q"4 ~"4 " " ""0 "" ##/#( 5#^#<,j#dd z#` ###l #1p #$$5$ 5H B$\$ d$$+T$$$T$ $ % %N%T i%{%a %%t  %% %%c &P4 &&H 7&l&4,}&&X &&&l &P '')'d  9' L" T'w'''('T''  ' '  ( (~ C(V(j, o(e\ ((( )\ !),\ /)C)d)`( r)))())*(T%*  :*Y* h* 2r*\ **8D **** +x + 5+\+|(n+̼ |++ +T++| ,@,S,e,p q,x ,(  ,t ,,,,-@-c-4----D ...` D.0 L.  e.|$(|..HT...6/#/F/t////'<,/ 030d D0X T0z0$&00+0014 1+1S1<,[1_ h11 1 1111; 2+2+2 92k2, v28 22224  3_D 3?3g3_ t3 3P 3( 338 3+44:4\4o444 4  44,,4( 5 5al 45P E5i5|555D54 5L 5626S6}666b 66 7  &7G7o7777L 7!8h@ ,80 @8]88889"9H9q9 9 999 98,9:%:I:Z: h:P s:::| 1O 2:::;b| ;: 4;];;;;;<,</opt/poky-sdk/2.3.4/sysroots/armv5te-poky-linux-gnueabi/usr/lib/crti.o$acall_weak_fn$d/opt/poky-sdk/2.3.4/sysroots/armv5te-poky-linux-gnueabi/usr/lib/crtn.ocommand.ccmd_try_do_shortcutconfig_terminal_no_lengthno_service_terminal_lengthbanner_motd_defaultcheck_baseconfig_write_terminalconfig_helpprint_attr_listshow_vty_attr_allshow_vty_attrshow_versionconfig_write_hostvty_pop_parentno_banner_motdno_config_enable_passwordconfig_no_hostnamebanner_motd_filecmp_desccmp_nodecmd_deoptxml_escapeprint_func_streamvty_dump_elementconfig_terminal_lengthindent_cmpcmd_ipv4_prefix_matchcmd_ipv4_matchshow_pidshutdownprint_func_vtyshow_uptimeconfig_listvty_command_is_commonvty_dump_nodesshow_online_helpconfig_passwordconfig_hostnamedesc_unique_string.isra.10cmd_node_vector.isra.12.part.13show_startup_configconfig_terminalinstall_node_baredo_echois_cmd_ambiguous.isra.16cmd_matchcmd_filter.isra.17cmd_complete_command_real.isra.18cmd_execute_command_real.isra.19cmd_describe_command_real.isra.20config_exitconfig_endconfig_write_fileon_dso_load_starttimeon_dso_loadCSWTCH.194cmd_lib_attr_letters__func__.8617__func__.8960char_mask.9283char_mask.9277config_write_terminal_cmdconfig_write_file_cmdconfig_write_memory_cmdconfig_write_cmdshow_running_config_cmddesc_cr.8803show_pid_cmdshow_uptime_cmdshow_version_cmdshow_online_help_cmdconfig_enable_cmdconfig_terminal_length_cmdconfig_terminal_no_length_cmdecho_cmdconfig_disable_cmdconfig_terminal_cmdcopy_runningconfig_startupconfig_cmdshutdown_cmdshow_startup_config_cmdno_hostname_cmdenable_password_text_cmdno_enable_password_cmdbanner_motd_default_cmdbanner_motd_file_cmdno_banner_motd_cmdno_service_terminal_length_cmdcmd_attr_desccmd_lib_attr_desccrtstuff.c__JCR_LIST__deregister_tm_clones__do_global_dtors_auxcompleted.9272__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entrybuffer.cdefault_size.6637line_vtyno_vty_loginno_service_advanced_vtyterminal_monitorterminal_no_monitorvty_redraw_linevty_forward_charvty_kill_linevty_self_insertvty_insert_word_overwritevty_bindvty_save_cwdvty_backward_charvty_backward_pure_wordvty_history_printvty_next_linevty_self_insert_overwritevty_prompt.part.5vty_delete_char.part.6vty_delete_backward_char.part.7vty_backward_kill_wordvty_describe_foldshow_historyconfig_whovty_config_writetelnet_space_chartelnet_backward_charvty_bind_portpassword_checkvty_bind_addrvtyvecvty_configconfig_who_cmdshow_history_cmdline_vty_cmdno_service_advanced_vty_cmdterminal_monitor_cmdterminal_no_monitor_cmdno_vty_login_cmdvty_bind_cmdvector.cutils.cpad_append_str.part.1pad_append_ctr.part.2rate_ctr_handler_fmttelnet_interface.c_telnet_init_dyniftelnet_new_connectionclient_datatall_telnet_ctxserver_socketlogging_vty.clog_deprecated_funccfg_no_log_systemd_journalcfg_log_systemd_journaldeprecated_logging_level_everything_vty_outputcfg_no_log_gsmtapcfg_no_log_filecfg_log_gsmtapcfg_log_alarmscfg_log_fileconfig_write_logvty_logpcfg_descriptioncfg_no_log_syslogcfg_no_log_alarmscfg_no_log_stderr_cfg_log_syslogcfg_log_syslog_localcfg_log_stderrshow_alarmsadd_category_strings.isra.9gen_logging_level_cmd_strs.isra.10cfg_no_descriptionenable_loggingshow_logging_vtyno_logging_level_force_alllogging_level_set_alllogging_levellogging_set_category_masklogging_prnt_filelogging_prnt_levellogging_prnt_cat_hexlogging_prnt_catlogging_prnt_tidlogging_prnt_ext_timestamplogging_prnt_timestamplogging_use_clrlogging_fltr_alldiable_logginglocal_sysl_map__func__.8149__func__.8603sysl_level_namesenable_logging_cmddisable_logging_cmdlogging_fltr_all_cmdlogging_use_clr_cmdlogging_prnt_timestamp_cmdlogging_prnt_ext_timestamp_cmdlogging_prnt_tid_cmdlogging_prnt_cat_cmdlogging_prnt_cat_hex_cmdlogging_prnt_level_cmdlogging_prnt_file_cmdlogging_set_category_mask_cmdlogging_set_category_mask_old_cmdlogging_level_cmddeprecated_logging_level_everything_cmdlogging_level_set_all_cmdno_logging_level_force_all_cmddeprecated_logging_level_all_cmddeprecated_logging_level_all_everything_cmdvty_logp_cmdshow_logging_vty_cmdshow_alarms_cmdcfg_log_stderr_cmdcfg_no_log_stderr_cmdcfg_log_file_cmdcfg_no_log_file_cmdcfg_log_alarms_cmdcfg_no_log_alarms_cmdcfg_log_syslog_cmdcfg_log_syslog_local_cmdcfg_no_log_syslog_cmdcfg_log_systemd_journal_cmdcfg_no_log_systemd_journal_cmdcfg_log_gsmtap_cmdcfg_no_log_gsmtap_cmdlogging_print_file_argsstats_vty.cstats_resetreset_rate_ctr_group_handlershow_rate_countersstats_reportasciidoc_osmo_stat_item_group_handlerasciidoc_osmo_stat_item_handlerasciidoc_rate_ctr_handlerasciidoc_handle_counterasciidoc_rate_ctr_group_handlershow_stats_asciidoc_tablecfg_tcp_stats_batch_sizeconfig_write_statscfg_tcp_stats_intervalcfg_stats_intervalcfg_no_stats_reporter_logcfg_no_stats_reporter_statsdshow_stats_levelshow_statscfg_stats_reporter_flush_periodset_srep_parameter_strcfg_no_stats_reporter_prefixcfg_stats_reporter_prefixcfg_stats_reporter_remote_ipcfg_no_stats_reporter_local_ipcfg_stats_reporter_local_ipset_srep_parameter_intcfg_no_stats_reporter_mtucfg_stats_reporter_mtucfg_stats_reporter_remote_portcfg_stats_reporter_disablecfg_stats_reporter_enablecfg_stats_reporter_levelcfg_stats_reporter_logcfg_stats_reporter_statsdshow_stats_cmdshow_stats_level_cmdcfg_stats_reporter_statsd_cmdcfg_no_stats_reporter_statsd_cmdcfg_stats_reporter_log_cmdcfg_no_stats_reporter_log_cmdcfg_stats_interval_cmdcfg_tcp_stats_interval_cmdcfg_tcp_stats_batch_size_cmdcfg_stats_reporter_local_ip_cmdcfg_no_stats_reporter_local_ip_cmdcfg_stats_reporter_remote_ip_cmdcfg_stats_reporter_remote_port_cmdcfg_stats_reporter_mtu_cmdcfg_no_stats_reporter_mtu_cmdcfg_stats_reporter_prefix_cmdcfg_no_stats_reporter_prefix_cmdcfg_stats_reporter_level_cmdcfg_stats_reporter_enable_cmdcfg_stats_reporter_disable_cmdcfg_stats_reporter_flush_period_cmdshow_stats_asciidoc_table_cmdshow_rate_counters_cmdstats_report_cmdstats_reset_cmdstats_class_strsfsm_vty.cshow_fsm_state_graphshow_fsmsshow_fsmshow_fsm_instsshow_fsm_instosmo_fsm_vty_cmds_installed.7891show_fsm_cmdshow_fsms_cmdshow_fsm_state_graph_cmdshow_fsm_inst_cmdshow_fsm_insts_cmdtalloc_ctx_vty.ctalloc_ctx_walk_cbtalloc_ctx_walkshow_talloc_ctx_filtershow_talloc_ctxshow_talloc_ctx_treeshow_talloc_ctx_cmdshow_talloc_ctx_tree_cmdshow_talloc_ctx_filter_cmdcpu_sched_vty.ccfg_schedcfg_sched_policyget_num_cpusgenerate_cpu_hex_mask.constprop.3show_sched_threadsmy_sched_setaffinitycfg_sched_cpu_affinityconfig_write_schedsched_vty_optsnum_cpus.9173cfg_sched_cmdsched_nodecfg_sched_policy_cmdcfg_sched_cpu_affinity_cmdshow_sched_threads_cmdtdef_vty.ctimer_command_stringtimer_doc_stringshow_timercfg_timerglobal_tdef_groupsshow_timer_cmdcfg_timer_cmd_divsi3.o.divsi3_skip_div0_testshift_dvmd_lnx.o__FRAME_END____JCR_END____aeabi_idivmod__aeabi_ldiv0__dso_handle__divsi3__aeabi_idiv0_DYNAMIC__TMC_END___GLOBAL_OFFSET_TABLE___aeabi_idivpthread_mutex_unlock@@GLIBC_2.4vty_resetvector_copyosmo_tdef_vty_out_onelog_set_print_timestamp@@LIBOSMOCORE_1.0talloc_get_name@@TALLOC_2.0.2osmo_str_startswith@@LIBOSMOCORE_1.0raise@@GLIBC_2.4cfg_description_cmdlog_target_file_switch_to_stream@@LIBOSMOCORE_1.0osmo_stats_vty_add_cmdsosmo_stats_reporter_set_max_class@@LIBOSMOCORE_1.0vector_empty_slotbuffer_freecfmakeraw@@GLIBC_2.4log_tgt_mutex_unlock_impl@@LIBOSMOCORE_1.0log_set_print_filename_pos@@LIBOSMOCORE_1.0vty_readbuffer_putstrcmp@@GLIBC_2.4vty_cmd_string_from_valstrcfg_log_node__cxa_finalize@@GLIBC_2.4vty_shellosmo_log_info@@LIBOSMOCORE_1.0vty_config_locktall_vty_cmd_ctxbuffer_newstrtol@@GLIBC_2.4vector_init_ITM_deregisterTMCloneTablebuffer_getstrvty_out_rate_ctr_group2vector_only_index_freeget_value_string@@LIBOSMOCORE_1.0__bss_start__vty_current_nodefopen@@GLIBC_2.4config_from_filevty_get_bind_addrread@@GLIBC_2.4tall_vty_ctxrate_ctr_group_reset@@LIBOSMOCORE_1.0show_vty_attr_all_cmdvty_nodelog_set_all_filter@@LIBOSMOCORE_1.0talloc_strndup@@TALLOC_2.0.2memmove@@GLIBC_2.4vty_out_rate_ctr_group_fmt2osmo_g_fsms@@LIBOSMOCORE_1.0loglevel_strs@@LIBOSMOCORE_1.0buffer_putccmd_execute_commandfgets@@GLIBC_2.4view_nodeconfig_list_cmdosmo_stats_reporter_set_local_addr@@LIBOSMOCORE_1.0log_target_create_vtypthread_mutex_lock@@GLIBC_2.4cmd_execute_command_strictpthread_self@@GLIBC_2.4memcpy@@GLIBC_2.4sort_nodetalloc_total_size@@TALLOC_2.0.2osmo_tdef_vty_set_cmdcmd_free_strvecosmo_stats_report@@LIBOSMOCORE_1.0_edatapthread_mutex_init@@GLIBC_2.4time@@GLIBC_2.4osmo_tdef_vty_parse_val_argprint_versionosmo_cpu_sched_vty_inittalloc_strdup@@TALLOC_2.0.2vector_countvector_freevty_ref_gen_mode_namesvty_createstpcpy@@GLIBC_2.4osmo_tdef_vty_out_alllog_add_target@@LIBOSMOCORE_1.0argv_concatuname@@GLIBC_2.4osmo_strlcpy@@LIBOSMOCORE_1.0_finiosmo_stat_item_get_last@@LIBOSMOCORE_1.0__bss_end__host_config_setosmo_vty_save_config_filelogp2@@LIBOSMOCORE_1.0osmo_tdef_val_in_range@@LIBOSMOCORE_1.0install_nodeosmo_log_vty2tgtsysconf@@GLIBC_2.4unlink@@GLIBC_2.4pthread_getname_np@@GLIBC_2.12vector_unsetosmo_ctx@@LIBOSMOCORE_1.0vty_newtalloc_reference_count@@TALLOC_2.0.2osmo_tdef_unit_names@@LIBOSMOCORE_1.0regexec@@GLIBC_2.4log_set_print_tid@@LIBOSMOCORE_1.0install_element_vechdir@@GLIBC_2.4vty_read_config_fileposmo_stat_item_for_each_group@@LIBOSMOCORE_1.0osmo_tdef_vty_groups_writeperror@@GLIBC_2.4vty_out_fsm__xstat@@GLIBC_2.4vty_out_rate_ctr_grouplog_target_create@@LIBOSMOCORE_1.0vty_out_statistics_fullaccept@@GLIBC_2.4buffer_writeosmo_vty_write_config_filecmd_make_strvec2osmo_stats_reporter_set_remote_addr@@LIBOSMOCORE_1.0Vvty_serv_threadstderr@@GLIBC_2.4vty_current_indexfwrite@@GLIBC_2.4log_set_use_color@@LIBOSMOCORE_1.0telnet_close_clientosmo_tdef_vty_out_all_varegfree@@GLIBC_2.4strtoll@@GLIBC_2.4cmd_make_strvecvty_out_statistics_partialosmo_str_to_int64@@LIBOSMOCORE_1.0logp_stub@@LIBOSMOCORE_1.0tcsetattr@@GLIBC_2.4config_end_cmdauth_nodestrcpy@@GLIBC_2.4vty_get_cwdvector_lookup_ensurevty_out_stat_item_group2vty_get_bind_portosmo_cpu_sched_vty_apply_localthreadopendir@@GLIBC_2.4osmo_talloc_vty_add_cmdsosmo_fsm_vty_add_cmdsosmo_stats_reporter_create_statsd@@LIBOSMOCORE_1.0log_tgt_mutex_lock_impl@@LIBOSMOCORE_1.0log_target_create_syslog@@LIBOSMOCORE_1.0vty_dump_xml_ref_modevty_is_activestrerror@@GLIBC_2.4log_parse_level@@LIBOSMOCORE_1.0buffer_putstrosmo_str_tolower_buf@@LIBOSMOCORE_1.0log_target_destroy@@LIBOSMOCORE_1.0config_exit_cmdosmo_stats_reporter_list@@LIBOSMOCORE_1.0log_del_target@@LIBOSMOCORE_1.0cfg_stats_nodeosmo_asciidoc_escape__ctype_tolower_loc@@GLIBC_2.4__gmon_start__vty_flushinstall_lib_elementkill@@GLIBC_2.4vty_out_newline__ctype_b_loc@@GLIBC_2.4osmo_signal_dispatch@@LIBOSMOCORE_1.0getcwd@@GLIBC_2.4getpid@@GLIBC_2.4install_lib_element_vecmd_complete_commandosmo_fsm_find_by_name@@LIBOSMOCORE_1.0show_vty_attr_cmdvty_go_parentosmo_fd_unregister@@LIBOSMOCORE_1.0vector_only_wrapper_freeauth_enable_nodelog_set_print_extended_timestamp@@LIBOSMOCORE_1.0osmo_tdef_vty_show_cmdosmo_stats_reporter_set_mtu@@LIBOSMOCORE_1.0strtoul@@GLIBC_2.4strlen@@GLIBC_2.4telnet_initosmo_tdef_vty_parse_T_arghost_config_fileosmo_tdef_vty_out_one_va_talloc_realloc@@TALLOC_2.0.2strchr@@GLIBC_2.4srand@@GLIBC_2.4osmo_tdef_get_entry@@LIBOSMOCORE_1.0osmo_counters_count@@LIBOSMOCORE_1.0log_set_log_level@@LIBOSMOCORE_1.0log_set_print_level@@LIBOSMOCORE_1.0osmo_str_to_int@@LIBOSMOCORE_1.0mkstemp@@GLIBC_2.4osmo_stats_reporter_set_name_prefix@@LIBOSMOCORE_1.0vty_out_stat_item_grouptalloc_asprintf_append@@TALLOC_2.0.2vty_ref_gen_mode_descvty_outvty_out_statistics_full2cfg_no_description_cmd__errno_location@@GLIBC_2.4config_nodeosmo_stats_tcp_set_interval@@LIBOSMOCORE_1.0_talloc_free@@TALLOC_2.0.2osmo_panic@@LIBOSMOCORE_1.0__isoc99_sscanf@@GLIBC_2.7log_category_name@@LIBOSMOCORE_1.0osmo_stat_item_for_each_item@@LIBOSMOCORE_1.0get_value_string_or_null@@LIBOSMOCORE_1.0__sched_cpufree@@GLIBC_2.7memset@@GLIBC_2.4osmo_stats_reporter_enable@@LIBOSMOCORE_1.0strncpy@@GLIBC_2.4osmo_tdef_range_str_buf@@LIBOSMOCORE_1.0vty_out_fsm_instinstall_elementosmo_log_target_list@@LIBOSMOCORE_1.0osmo_sock_get_name_buf@@LIBOSMOCORE_1.0osmo_fsm_state_name@@LIBOSMOCORE_1.0vty_cwdosmo_fsm_event_name@@LIBOSMOCORE_1.0fileno@@GLIBC_2.4cmd_init__sched_cpualloc@@GLIBC_2.7osmo_counters_for_each@@LIBOSMOCORE_1.0__end__vty_out_fsm2sched_setaffinity@@GLIBC_2.4vty_shell_servvty_closeosmo_stats_reporter_set_flush_period@@LIBOSMOCORE_1.0stdout@@GLIBC_2.4writev@@GLIBC_2.4logging_vty_add_cmds__bss_startfclose@@GLIBC_2.4vector_lookuplog_target_file_switch_to_wqueue@@LIBOSMOCORE_1.0cmd_prompttelnet_init_defaultlog_parse_category_mask@@LIBOSMOCORE_1.0log_level_str@@LIBOSMOCORE_1.0talloc_total_blocks@@TALLOC_2.0.2osmo_tdef_vty_groups_initbuffer_resetosmo_strrb_get_nth@@LIBOSMOCORE_1.0log_target_create_file@@LIBOSMOCORE_1.0buffer_emptytelnet_exitvty_read_config_filecmd_describe_commandlog_parse_category@@LIBOSMOCORE_1.0vty_config_unlocktalloc_report_depth_cb@@TALLOC_2.0.2osmo_stats_reporter_set_remote_port@@LIBOSMOCORE_1.0osmo_tdefs_reset@@LIBOSMOCORE_1.0readdir@@GLIBC_2.4osmo_stats_config@@LIBOSMOCORE_1.0vfprintf@@GLIBC_2.4vty_cmd_range_matchvty_init_vtyshosmo_stat_item_get_desc@@LIBOSMOCORE_1.0cmdvecconfig_help_cmd_Jv_RegisterClassesbuffer_flush_availablevty_dump_xml_refosmo_stderr_target@@LIBOSMOCORE_1.0sprintf@@GLIBC_2.4osmo_fd_register@@LIBOSMOCORE_1.0regcomp@@GLIBC_2.4default_motdvector_set_indexvty_install_defaultosmo_sock_init_ofd@@LIBOSMOCORE_1.0rate_ctr_for_each_counter@@LIBOSMOCORE_1.0log_check_level@@LIBOSMOCORE_1.0talloc_strdup_append_buffer@@TALLOC_2.0.2osmo_stats_reporter_disable@@LIBOSMOCORE_1.0osmo_stats_set_interval@@LIBOSMOCORE_1.0vty_out_fsm_inst2vsnprintf@@GLIBC_2.4qsort@@GLIBC_2.4vty_out_rate_ctr_group_fmttalloc_named_const@@TALLOC_2.0.2log_set_print_category@@LIBOSMOCORE_1.0log_target_create_gsmtap@@LIBOSMOCORE_1.0osmo_tcp_stats_config@@LIBOSMOCORE_1.0_talloc_zero@@TALLOC_2.0.2vty_out_statistics_partial2osmo_stats_reporter_free@@LIBOSMOCORE_1.0vector_setosmo_tdef_vty_writesched_getaffinity@@GLIBC_2.4log_set_print_category_hex@@LIBOSMOCORE_1.0log_cache_update@@LIBOSMOCORE_1.0log_target_create_stderr@@LIBOSMOCORE_1.0talloc_strndup_append_buffer@@TALLOC_2.0.2get_string_value@@LIBOSMOCORE_1.0log_target_create_rb@@LIBOSMOCORE_1.0log_set_print_filename2@@LIBOSMOCORE_1.0_ITM_registerTMCloneTablevty_hello__tls_get_addr@@GLIBC_2.4osmo_stats_reporter_find@@LIBOSMOCORE_1.0vty_eventtall_vty_vec_ctxsync@@GLIBC_2.4log_target_find@@LIBOSMOCORE_1.0osmo_clock_gettime@@LIBOSMOCORE_1.0chmod@@GLIBC_2.4vector_ensurevty_out_vaassert_loginfo@@LIBOSMOCORE_1.0strncmp@@GLIBC_2.4vty_out_uptimeactive_connectionsosmo_strrb_elements@@LIBOSMOCORE_1.0closedir@@GLIBC_2.4buffer_flush_alllogging_vty_add_deprecated_subsysrate_ctr_for_each_group@@LIBOSMOCORE_1.0osmo_stats_reporter_create_log@@LIBOSMOCORE_1.0sched_setscheduler@@GLIBC_2.4log_target_rb_avail_size@@LIBOSMOCORE_1.0tcgetattr@@GLIBC_2.4talloc_asprintf@@TALLOC_2.0.2talloc_set_name_const@@TALLOC_2.0.2tall_log_ctx@@LIBOSMOCORE_1.0.symtab.strtab.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_ranges$.o8 @(Ho55Uo88d \9\9m BGGvOO qOO |[[ 6((00u         ( ++0+p+)+`,.L./+(1H8p1H1O  hJ<F