ELF( d44 ('&p444  TTT   Uc>> > hhpppDDQtdRtd   44/lib/ld-linux-armhf.so.3GNUGNURU >iDJce@ C)! U PA PL@ "2+o A1aE Pd2 "^ `F"T M*R`4BCTKT !d X)@;8 CB \Ab( '!R ' & ldDŠ#$@@(h @*)S(F aP+ y B  !"#$%&'()+,-./023456789:;<=>?@ACDEFGHJKLNOPQRSTUWXZ[]^`abcdeghijkmnopqtvxyz}~    !#$%'()*+./03568:;<=>@CDFGHIJKMNOPRSTUVWXYZ\]^_`bcdf9ځW pU< \\4QURjLP7zsS@@M|icoMOA3mK?~|4mgUGqjCwɑF/N='ֽ3u H Yqw|nh.7%vKëvoDz?vk ^{% ìI Yh|1͟i.K}3;wTkƛǑ%_gIɥ;3qK'$?  apGu]7z[#%e㸏qeaWPH.Lu6&CEJEK .)+W>&[gɔQΒcBNyܾ]^-<'&ޤK3u Mvҝ/Қ9v 6O'PzCvכ|/ C67i=9:ŗ{Fės鷺e悉 OqE̝#Fo>Ɗ<],2@q ho׹|# e ,XϱNu{9=S.{fkNֺ[;[8 |7w4a ( n?h: BM 3 x{ g +/-a<  JMak <svg t( _   ^zDR  a .J< #  EE53_ 2  h&   )S  v w \& +2 n .w 0 $  V m  `   a 1 HB 1 (6 Yf^S&t0 n Y7lh &aa a }C 2 ; pa \ BL okQn  #I\0a 0 libosmoctrl.so.0_ITM_deregisterTMCloneTableinstall_node__gmon_start__vty_out_Jv_RegisterClasses_ITM_registerTMCloneTablectrl_interface_setupctrl_parse_get_numctrl_cmd_def_makectrl_cmd_installctrl_vty_initctrl_cmd_def_sendctrl_cmd_def_is_zombielibosmoabis.so.13vty_out_rate_ctr_groupe1inp_ipa_bts_rsl_close_ne1inp_line_bind_opse1inp_line_updatee1inp_signal_nameslibosmo_abis_inite1inp_line_createe1inp_signtype_namee1inp_ts_config_signe1inp_sign_link_destroye1inp_ipa_bts_rsl_connect_ne1inp_line_find_finiabis_sendmsge1inp_vty_inite1inp_sign_link_createlibosmotrau.so.10osmo_fr_check_sidosmo_hr_check_sidosmo_efr_check_sidosmo_hr_sid_resetosmo_fr_sid_classifyosmo_efr_sid_classifyosmo_rtp_socket_freeosmo_csd144_to_atrau_bitsosmo_csd_ra2_16k_packosmo_rtp_socket_set_paramosmo_rtp_socket_statsosmo_rtp_socket_createosmo_rtp_socket_set_dscposmo_rtp_socket_connectosmo_rtp_set_source_descosmo_csd_ra2_8k_unpackosmo_rtp_socket_pollosmo_rtp_send_frame_extosmo_rtp_socket_bindosmo_csd_ra2_8k_packosmo_rtp_skipped_frameosmo_rtp_initosmo_rtp_socket_log_statsosmo_rtp_get_bound_ip_portosmo_csd_ra2_16k_unpackosmo_csd144_from_atrau_bitsosmo_rtp_socket_set_priorityosmo_rtp_socket_set_ptlibosmovty.so.13install_elementinstall_element_veosmo_tdef_vty_groups_writelogging_vty_add_cmdsosmo_log_vty2tgtosmo_stats_vty_add_cmdsvty_ref_gen_mode_desccfg_no_description_cmdvty_cmd_string_from_valstrtelnet_init_defaultvty_ref_gen_mode_namescfg_description_cmdosmo_fsm_vty_add_cmdsosmo_talloc_vty_add_cmdsvty_read_config_filevty_dump_xml_ref_modelogging_vty_add_deprecated_subsysosmo_cpu_sched_vty_initprint_versionosmo_tdef_vty_groups_initlibosmocodec.so.4osmo_amr_type_namesosmo_fr_sid_resetosmo_ecu_destroyosmo_amr_rtp_decosmo_ecu_initosmo_ecu_frame_outosmo_ecu_is_dtx_pauseosmo_ecu_frame_inosmo_efr_sid_resetlibortp.so.10libpthread.so.0recvfromraisesendto__errno_locationacceptrecvlibrt.so.1clock_gettimelibosmonetif.so.11osmux_xfrm_input_allocosmux_xfrm_input_set_deliver_cbosmo_rtp_handle_freeosmux_xfrm_output_set_rtp_ssrcosmux_xfrm_output_pullosmo_rtp_buildosmux_xfrm_input_open_circuitosmux_xfrm_input_set_nameosmux_xfrm_output_allocosmux_xfrm_input_close_circuitosmux_xfrm_input_deliverosmux_xfrm_output_set_rtp_pl_typeosmux_xfrm_input_set_initial_seqnumosmux_xfrm_input_get_deliver_cb_dataosmux_xfrm_input_set_batch_sizeosmo_rtp_handle_createosmux_xfrm_output_set_rtp_msgb_alloc_cbosmux_xfrm_input_set_batch_factorosmux_xfrm_inputosmux_xfrm_output_set_tx_cbosmux_xfrm_output_schedlibosmogsm.so.20abis_mm_event_cause_namesdbm2rxlevosmo_csd_12k_6k_encode_framelapdm_phsap_dequeue_prim_fnlapdm_t200_fnosmo_tlvp_mergeabis_nm_pchan4chcombabis_nm_att_namestlv_def_patchgsm0858_rsl_ul_meas_encrsl_chan_nr_strabis_nm_att_tlvdefosmo_csd_12k_6k_decode_framegsm48_chan_mode_namesrsl_att_tlvdefabis_nm_nack_cause_nameabis_nm_ipa_magicgsm48_number_of_paging_subchannelstlv_parsersl_ipac_eie_tlvdefrsl_err_nameosmo_rlp_decodegsm_band_parselapdm_phsap_uplapdm_channel_exitlapdm_channel_set_flagsrxlev2dbmabis_nm_dump_fohosmo_gsm48_rest_octets_si3_encodeosmo_gsm48_rest_octets_si3_decodeosmo_gsm48_rest_octets_si4_encodelapdm_channel_set_t200_fnlapdm_channel_init3osmo_tlvp_copyms_pwr_dbmosmo_gsm48_rest_octets_si4_decodeosmo_bts_features_descsosmo_gsm48_si1ro_nch_pos_decodeabis_nm_put_sw_filems_pwr_ctl_lvlgsm48_rr_msg_namersl_rll_push_l3lapdm_rslms_recvmsgabis_nm_osmo_att_tlvdefabis_nm_adm_state_namesrsl_or_ipac_msg_nameabis_nm_opstate_nameabis_nm_avail_namegsm0502_calc_paging_groupgsm_fn2gsmtimegsm_gsmtime2fnrsl_msg_nameabis_nm_fail_evt_vrepgsm_band_nameabis_nm_obj_class_namesabis_nm_att_tlvdef_ipagsm_chan_t_namesrsl_act_type_namesipa_prepend_header_extabis_nm_osmo_magicgsm0808_chosen_enc_alg_namestlv_parse2lapdm_channel_set_l1lapdm_channel_set_l3gsm_fn_as_gsmtime_strosmo_dump_gsmtimeosmo_csd_3k6_encode_framersl_rll_simplegsm_arfcn2band_rcosmo_plmn_from_bcdabis_nm_chcomb4pchangsm0502_fn2ccch_blockosmo_sitype_strsrsl_ipac_msg_nameabis_nm_msgtype_namesosmo_csd_3k6_decode_frameosmo_rsl2sitypelibosmoisdn.so.0osmo_v110_decode_frameosmo_v110_encode_framelibosmocore.so.22_osmo_tdef_fsm_inst_state_chgbitvec_get_bit_pososmo_init_ignore_signalslog_set_log_levelbitvec_unpackosmo_sock_init2_ofdosmo_fd_update_whenosmo_fsm_inst_namebitvec_allocosmo_hexdump_nospcosmo_sockaddr_str_from_sockaddrrate_ctr_initgsmtap_source_init2log_parse_category_maskosmo_sockaddr_cmposmo_wqueue_clearrate_ctr_addosmo_wqueue_bfd_cbrate_ctr_group_get_ctrosmo_fsm_registerosmo_tdef_getmsgb_freeosmo_signal_register_handlerosmo_ubit2pbit_extbitvec_set_bytesosmo_log_inforate_ctr_group_resetgsmtap_send_exget_string_valuemsgb_allocbitvec_set_uintosmo_signal_unregister_handlerosmo_sockaddr_to_strosmo_select_mainlog_check_levelosmo_daemonizeosmo_timer_setupmsgb_talloc_ctx_initosmo_sockaddr_to_str_bufosmo_fd_setupgsmtap_sendosmo_timer_pendinglogp_stubrate_ctr_group_alloc_osmo_fsm_inst_state_chgosmo_timer_scheduleosmo_isqrt32osmo_sock_unix_initmsgb_dequeueosmo_signal_dispatchgsmtap_source_add_sinkbitvec_get_uintosmo_strlcpyosmo_fd_unregisterosmo_fd_registerosmo_hexdumpmsgb_dataosmo_panicosmo_init_logging2osmo_fsm_inst_freeosmo_wqueue_enqueuebitvec_set_bit_pososmo_timer_delmsgb_enqueueosmo_tdefs_resetosmo_str_tolowerbitvec_set_bitosmo_stderr_targetlog_set_use_colorosmo_fd_closelog_set_contextget_value_stringosmo_wqueue_initosmo_sockaddr_str_from_in_addrmsgb_hexdumpbitvec_free_osmo_fsm_inst_dispatchosmo_fsm_inst_allocmsgb_copyosmo_stats_initlog_reset_contextosmo_fsm_inst_update_id_fmsgb_lengthosmo_fsm_state_namelog_set_print_timestamposmo_crc8gen_compute_bitsosmo_get_macaddrget_value_string_or_nullosmo_pbit2ubitosmo_vlogplogp2libdl.so.2libtalloc.so.2_talloc_memdup_talloc_set_destructortalloc_pooltalloc_strdup_talloc_zerotalloc_named_const_talloc_freetalloc_asprintftalloc_set_name_consttalloc_report_fulltalloc_enable_null_trackinglibsctp.so.1libc.so.6fflush_IO_putcfopenstrncmpoptindperrorinet_ntoasignalputsabortgetpidinet_pton__assert_failstrtolstrlenmemsetwritevfseekmemcmpgetnameinfostdout__isoc99_fscanfstrnlenmemcpyfclosestrtoulmallocsched_setschedulergetpeernameoptargstderrreadvgetopt_longfwritefreadfprintfgetsockname__xpg_strerror_r__xstatmemmoveopterrstrcmpstrerror__libc_start_mainrandomsnprintf_edata__bss_start__bss_start____bss_end____end___end/usr/local/jenkins-build/inst-osmo-bts-oc2g/libLIBOSMOISDN_1.0TALLOC_2.0.2GLIBC_2.4LIBOSMOCTRL_1.0LIBOSMOCORE_1.0GLIBC_2.7LIBOSMOGSM_1.0             U q  "  ii  @q: q#-h ii 0ii =ii !  GD < < \ T\ 5$  | ` J% \&  t( t0 30 0 eT1 .1 #1 )2 M3 03 ; Q; D` =a a Da ma F a "(a |0a b4a  @ @ W@ @ @   @ $@ (@ ,@ 0@ 4@ 8@ A<@ :@@ $D@ H@ L@ RP@ T@ X@ a\@ U`@ ]d@ h@ Jl@ p@ t@ cx@ |@ @ @ @ H@ X@ I@ @@ ;@ @ X@ 6@ I@ @ @ @ @ @ B@ [@ *@ 8@ @ @@ @  @  @ ,@ @ @ @ @  @ GA A A  A A A A OA ( A e$A (A ,A x0A 4A d8A 8C fdD YhD lD CpD tD xD |D %D aD D :D D <D D PD ^D D 1D D D D D D D SD D D D D D !D D D D D HD D  @--Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌxƏ~ʌpƏ~ʌhƏ~ʌ`Ə~ʌXƏ~ʌPƏ~ʌHƏ~ʌ@Ə~ʌ8Ə~ʌ0Ə~ʌ(Ə~ʌ Ə~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌƏ~ʌd* @- @@@G0s@- @P@Ѝ*  @@@0`P @- @P@Ѝ   @@@0N @- @P@ЍL!l  @@@0 : 6 2 . * & "  : 0:&.dЍ@`Ѝ1 0@ R cP t&p@ @C0gt60@@C: ! // 0H Bm``ap `@ЀQ ,Mq0KU@@  PP0@ 0d  "1 0@ R P @@&0 @A ,Ѝ@`Ёء $Ѝ160@@AC @eBmW`,fD~P@`@ M p@ @0  @p MP wP@D00 Ѝ@`Ёء Ѝ/0X0/@ Riiiiiiiiiiiiiiiiiiiiiiii///1@m@ 0@PMU PЍ@Ѝ0@@L* @@00:L  @0@ @-@Ѝ@mP@MQ 1 0@ R WPЍ@ЍT0@L*0 @7T:L 0@@Bm`pD* @M`0PX<@@PQ P@0S` PH?0@1S > 0@ 1008 P4ZT Pk=0@!Rx<8 0@100P RI PP?0@ @@(0,@Ѝ@`ЁЍ|:*X0@ @ @L*0 @`@,:L 0@ @ @:L  0@@|:X0@@ ;L 0@@ @0@L*0 @0&@L*@ @0ZPU8 oP @0@L*0 @0@h~PU& QP @0@L*0 @0@J`@:L  0@@x @:L  0@@lAm8P1`@ 0@ MU PU P 0@}H0@L*0 @[0`V P 0@bH;L  0@[@20@Up;L  0@^@%0@HpL*@ @^0 mAmP` MU> U U UA AQr(s\srr|rdsrrLrLrdsrrdsdsdsdsq PUL*  @@@2O Ol4 nD &bf V&V@@UTpЍ@` Ѝ PP R L*  @@@2'7oEQlsrssPtPtPtssU 1 0@@To YP L*P@@ @2@EQ2sttstttss1 0@`VP 0P L*@@ @3! R  R PP1 0@@T4  P @L*@ @2@P1 0@@T+ P @L*@ @2@P<L P@0@ .W<L P@0@ $M<L P@0@ C;L P@0@ 91 0@ R P 40@L*0 @3B Nd4<L `0@@0AmP `MR3 A` @@0S_ P p@ @0@L*0 @V> W1rL:40@  hsL:\0@  `(A` @@0S< [PQV9 @T? QP @0@L*0 @f5@Ѝ@`ЁЍ䠜p@ @< L 0@V@l p@$+ @ @<L  0@f@R p@xBm@P` Mu :1S  l1 0@`PU:V PRr400S@#L@p7s` @PM@T V P@PP M@0 彏T0 s{O W VL P.400S Ѝ@`Ёء Ѝ 5r 0 @DL*@ @ 5 ',   @@@00 @$0@L*0 @5-  @@@0 @$=L  0@@ @D=L  0@ @b@mPLJ M@@?H 407I \00 Ѝ@Ѝ- M00 Ѝ- M00 Ѝd-@MP #80< @Pڶ3 < 03ЍDD B0Cl @Bm`pP DM00, :1S0 P`lU @[<0 , 0C,00 (00 $@S RR00R0SX0 SS00O,1.D80 +41ᜳc1,^^ 0 @R (  0 0$ S k <  B1 0@Z  PwP 1 0@@T P$P  0DЍ@`Ёء Ѝ 0 @s ! $>PY O<4,>D;8"2ᑳc&S S2S1^4  ( 0RR00R00S? R 0 @S1 0 S1 PP"14800r Q  @Q R 800 R p0@40>40S:48UO, .D +48#1ᜳcS1I48D$w$0 `@4?0@L* @u? d$,0OP $0:<044 00,0RQ` $ ?P :4$ R d$/ Q <  BR%,   @@@0s-  @@@0k$0 ` ( h( 0@01L* @C$0 `R4? 0@uL @ $0 ` , C((?, 0@L  @ 4 R= RW 4 B ,0$0R 3 < L00 ,0R   R   R     4(0<0 8d$04848~ 4 @.  @@@0!48 m!48 g48bO<!>D8 +4 #1ᒳc 4 S1048Q48M1 0@PU& P $0 `P @0L*0 @c?"@RiL*  @@@1$0 `p >L  0@cp@ @1 0@ R P L*P@ @W1Xn=L 0@@WBm@P0`p |M0CSBԆԆԆԆ@dL` @[ Pi0  R ' R    LP @T bP @|Ѝ@`Ёء Ѝ$0S T`R9 0@!> 0@ 0 @  c ! $kP 0S% #+R9 0C,@ 0 0<0$0 P @$0S~ T`P0 0P0(1VPLĠ 0 NL% `   hL@$0S^  Tp @R9 0@!> 0@ v`V P00CS`VU Pu 0@L*0 @4 ed$0S' T`R9 0@!> 0@ A0 @  c ! $pP41 0@`V) P _@<-d  @@@0CC`  @ L*@ @ 3` 4 PP R 0LЀS@1 0@ R{ aP' 0 C j 0C0H $ 0zjpjz:0z'z'z:1131zzgz:1#80<$AQ3 %<  v  P@L* @4(2z  1z  /z  *3+S,@ @0 0<0 P0 0@ 2z  1z  /zL @  5 P X0L`1z/j2z, zx*F# *Cr :z1z{ 0؃s0#{z3800P 00 C SR#D0S <SC!0 r 0CSࠃ@1t3+S!,0@@p,<p@DP@P #TLP X&#\`&$& !!00Q@' 60 0@L @*p  @ ? 0@pL @@@F  @\\`@ 0@ 0 SgfF %AA#LaR!  L 8  @$%51@L* @00z3 z  z8   &0D0E  @rtL*@ @3 h@ @#@RL<  @R8$%?0@< (z8  z  z L @  d0@L*0 @3WT  @ t? L 0@@0 q?L  0@@2@Dl 0CD B@ <@8@-@MP #80<L\ ڶ#7<03Ѝ@ЍGDl D B@0C@Bm@ 0` 4M0q0 4 S  S S 1 0@ Rd AP@4Ѝ@`Ёء Ѝ 2@P :,01SY O,p.D( $ lP(0* RR #1ᒣcS10L10 0 0 W`b Pg  \ $00 0 < N PH0 R,   局  PP. fJ0P$0k ,0 p1S-  @@@0y 0 000 %Q (![ *j     {  &PP @^PY :!R 0AS8긖``80@L*0 @2@@ <D0S@@2l`90PS00S5@&.0S? Sg @TE ;1 0@ R} QP 0@L*0 @j2@,   @@@0 : L' Z0L70S 0S 0@L7@@.  @@@01 0@@T!  P `@ 4?0@L* @'2  h@`*P7S @a@`P 4? 0@'L P@*81L 0@@!1L 0@@j@Am``pMQ 1@ 0@PUS P<P@U.@T+ 80S0 0R40P,< 0@p0p 00 01S1$ 0@ TR P 0 0 zjzzZ00L*@ @51L 0@@;zDBm`pP ,M j1S l@ "Q @ P@@夡 契 01 0 01$001山  $ Ra P@ 1Zn PA1# @480S0Ӽ1Q&P 1P ,Ѝ@`Ёء Ѝ RP P T0@L*0 @60@L*0 @5 00L*@ @5<L 0@@,   @@@0-  @@@002L  0@@T2L 0@@y@-@M @85  0@@Ѝ@ЍAmAP` @@pM `R PPPPЍ@`ЁЍ0@L*0 @"M62L P0@@M. R PB 20@L*  @ V6n2L 0@@VAm`pPMm :1Sq A ` @@lPYO P$X @Td P-@@}0 0@ @@TЍ@`ЁЍ @0@L* @0(6X @0@L*0 @/6 @2L  0@(@X,   @@@0-  @@@0 @2L  0@/@~AmP`a `@ 8M R &Pd#u @@PL 00 0$P\00d00`00X0Sa-P, 1 ,P$ m? -P0 1&P30S 10140S 10150S 10160S 101PU 1P1P8Ѝ@` Ѝ!8 R00 00R P L*P@ @6P x&PP # Ri P x0@L*0 @68,30@ L*0 @6 '` RJ ~Pk L*@ @P6_ RE jP 0@L*0 @w6P01U{ ,3L 0@@'<@@Vu1L@@Mlx3L 0@@%3L 0@@y4L 0@@rJ3L 0@@wk@-@x1u1@ЍAm@`` Mp 0P0 :0@  `s@: 0@@` Ѝ@`ЍPBm` ,M`  1Sd Qpl` P@@X: P0S Xp XV  @$0 X@(,Ѝ@`Ёء ЍX@"X @\0@L*0 @7 ; X@$ X @$ \40@L @  ,   @@@0*-  @@@0" R: iPL*@ @&7 R* RP L*@ @7 R ?P 0@L*0 @75L 0@@&u4L 0@@n4L 0@@g@-@M@<  0@@Ѝ@ЍAmP`M@P tP`l_ 1TPQ 8Q ?Qq p@# L4Q )h2 0)?A0CSq p@ R P 1H@L*u7 @d R PoT)0 0P`(1S~ lP1|+@ `0#  BRꐲ`LxLLL81 0@ R P Ѝ@`ЍT *0 ST *T *T * ,L*`@ @7 0 0)7 0L*  @@@71x@L*z7 @x5L z0@@~TwPP-?(b A%EScPtH5L 0@@uiZ1 0@ R P 0@L*0 @7,5L @0@Lu5L 0@@D@-@]K@Ѝ0P /AmP@`||g p@@`@ p0U@ @`ЍP@m@4M 0P B 0  0@}4Ѝ@ЍAmQ@ P@ ``MR P:QL q:!Q$ AQQPp0Pj PPPP%$00p 0]} 0Qv 0 00 000Ѝ@`Ѝ7`@0@' @03 Q0 S0000@T3 =P^ \ `@ @0@'0 @4 ^0 S000007`@0@@@Wn`P\  @z7 0@@PI^0 0Q 0  0Qv 0@ 0Qm 0j 0 !rAmAP @@`p`MXJ P%0S7 P z0@'0 @4  S=zzzgzЍ@`ЁЍ_T0@'0 @4 10Sz70@@  @T,7 0@@zDu0Am@`MPU 1` 0@pW$ _P @Ѝ@`Ѝ @0@'0 @U? @8 0@U@{ Am> `0@P$M R! $`^1 0@pW7 Pƒ$Ѝ@`Ѝ@,!#<`P-8!: @00@@8(P p @@H @  ' @7@,!#<`PY-81 @@0@8P@p8 0@   @H@ @ 'X  @@@7m@m@MQ(00Ѝ@Ѝ 0 0 0 1P 0@ R P 00@'0 @"00:P0@@@-P@MT 0 (PЍ@ЍH1 0@ R QP '@@ @3U80@@ Am> `0@P M R! $` 1 0@ R# %PЍ@` Ѝ0#<@`' @t7'X  @@@r7@8#L`0@@tDAmAA`P @@MQ'888$8h8888888880S P 0'@0 @4f0Su P l0@'0 @4SЍ@`Ѝ0S P 0'@0 @40S P 0'@0 @40Sg P 0'@0 @40S sP 0'@0 @40Sc bP1@w`@p@ P0S TP`U0Sl30@@ Ѝ@`Ѝ4 0 y0 @'0 @4@ 80@@ `O80@@ VE80@@ L;9 0@@ @80@@ 6%80@@ ,BmP`` $M0ST *pPW  F@1 0@pW P1$Ѝ@`Ёء Ѝ  l@0 Ƞ <45!0@ @180Z 0K P, 0$Ѝ@`Ёء $Ѝg0+P+D'P@ @? !,   @@@0*-  @@@0"<**P @0@'0 @2 P<" **P @ 9 0@@ P*@*D9 @0@@yk00CS ////\ R 01P  01P Q/ /P@-  1S l0@Ѝ ,   @@@0-  @@@0Am@P` MC :1SG lP` 0 8 <1 0@ R% P h$  @0PЍ@` Ѝ 0@'0 @1JЍ@` Ѝ 90@@,   @@@0C-  @@@0;P- M  1S l0M S  Ѝ,   @@@0-  @@@0R 0A P SR 00  00( 00S S 1@mP 0@@MT =PЍ@Ѝ / /`@@' @@ =`9@0@ f 0 S0 S/ 3C 0S /BmhP@` $MQ񟗸T0x00S :1S la0 `@ 0p 0 Ƞ<0p 0 P00 U40 8<0j P0S P (@% 0@'0 @/6H*  @0x$Ѝ@`Ёء Ѝ00S :1S ln0p` 0P 0 Ƞ<0P  [ F`0 408 <00RHHH00S< :1S@ lp'0 0` 0 Ƞ<0}`00  0 4 0 8<0$PI5!0@ @1hPYP Pu% &\$ @0f,< 0@ @@  pp kN,< 0@ @@ 00S :!R 50@l1 `RJ|P(pQ `FCvPEp Qz0`V :1S l0 0p 0 Ƞ<00p   ~ 0 00 4 0 8<0P0S a `@PUl }P0Ss uP v$   @0ANP :8 00H3L0a `@Z WP X0S LP.  @01 0@ R :PV,< @ 0@@ :0S  1 0@ R= Pῴ Gp,   @@@0-  @@@000 0`0@'0 @6`)  ;P @@0@'0 @2v `@@A0@'0 @-6 d(@0 0@'0 @O4Sf `@@0@'0 @L4 @?G(`@P 0@'0 @5 P+u8 @\@@' @[5 P `@ @D0@'0 @W5 :0@@ `@ @: 0@-@@(@2 0@ O@` @@9 0@L@@x`(@: 0@@Pi 0Sp0 0s`@  @D: 0@W@@O\:0@@ [A>MPl :80h(@\2 0@ /@,9`:0@@#5&AmhP` lUP0 @` Ѝ@h0U P 0AmP+@ @`` r* 0  @` P@`Ѝ 0AmP+@ @`` W#0  @` P@`Ѝ  0p\p / 0\0+Am @@P` *0 `  P@Ѝ 0@m0MS" :1S& Q@P*h h0R Ѝ@Ѝ0S o0SA $0JS0L7,   @@@0-  @@@01 0@ R P `0@'0 @e4 PᰲhP% 5`;0@@ePAQ{0Am@P``+  @0 `` P@Ѝ 0+@- @@0 @Ѝ AmP,`h`< @ 0@@MpW h0 7/h@U h0U#h0U P Ѝ@`Ѝ1 0@0S@;X+`h0@ @UPPt;"0@@ 1 0@0S vP `@;X h`0@@t@' @UPP3 P@[`P@Bm@` 4MqpQXWppkQYh9.  @` 8##$0 ^ Q P@ R 5P0S -P p W\R "P   9@p#0 0  > 0@) $0hp=(0`W 0\ R P t``P@' @[3 @P 1 0@ R P ;4Ѝ@`Ёء ЍR P  @00  @p(0)(0@' @I3K (@ 0@'0 @ =9k`0 @(0(0'@ @0>3 &0SQ(@2 0@ @I Qv Rs  Rx eP 0@`'@0 @S3`p ( @;>( 0@p@ @'@ @p?   0t<`@@ 0@[PrR , @(  @p( <I0@@, \ ( @};( 0@@L 0'@0 @93;0@@9:`@<0@@S1Bm@` MqPQxWUPP+Q[(9.  @ 7##0  a `@ R P0S S. 9 @L+#0 Rb<1 0@ R PЍ@`Ёء Ѝ0S P. 9 @L {+  ?0S ~P. 9 @L {+  -0S lP. 9 @L {+  0Sh ZP |0@'0 @50SK FP0h =(0 Rh v0S 3P |0@'0 @+5$( [}`000'@ @ 05 L`P y7 0@P@H=< 0@@ ?|20@@ 7<0@@ /U<0@@ Q'q<0@@ W Rc P+ 0`'@0 @#5a0'@0 @4|20@@ + ;0@@> )0@L @5!' @PP3L0@'0 @Q>'0@'0 @50@'0 @5`=0@@#uBm@` 4MqQxWXoQ4`S$0i9.  @7##(0 ` Q P@Z <P0S 4P Z_X )P  $9@p# #00 >  0@$0s'pp(0hp=(0`W 0\ R P t``P@' @6 @P 1 0@ R P @4Ѝ@`Ёء ЍZ P @4  @.x0@'0 @< O(@ 0@'0 @5>i `@ ,'@5 @ -0SQ(@2 0@ @I Qx Ru  Rt lP 0`'@0 @ 6` @,= 0@@ @H'@ @5  0t<`@@ 0@P|W @  @, , x=0@@ f @H= 0@@V0'@0 @_>;0@@_E `=0@@ < 0 40 8 /q0Q(RS00 QQ > 0@!!#//0Bm0` MSg :1Sk pl@fh h0R 1 0@ RL P2:P7S> 50@1X |@(0⤮ `@0@ U[d R `@V U HLP uЍ@`Ёء Ѝ`0@'0 @4:P7S `=0@@,   @@@0 -  @@@0Am@QP` M 0S Ѝ@` Ѝh h0R`V߬ g:'RGZ1 0@ R "P ` 0@'0 @96Ṭh! ?` >0@@9KAm@P`pM`EV, 1 0@Yh PDL0S S5 @\A7 0@㜀(Ѝ@`ЁЍG740@ )0S2 SL0PSUN  NϠ@\7 㑅(0@'  @@@!1S@p @ 80@'0 @1 ,J74 0@}@p @8> p0@@'  @@@:10@@.Am@P`M` :1Su Qpl P@`XD !P&Q PUj PL@g$0Q 0&  0 UЍ@`ЁЍ @fx0@'0 @i1Q *  @W @Mx>i 0@@Q ,   @@@0z @50@'0 @n1X-  @@@0a @> 0@n@0.  @0 ! <AmP` -@r@ 00(  @0@` ЍU0S R@-@Ѝ/Q@- R @Ѝ @Ѝ @ЍQ@- _@Ѝ/AmP` U @ L F@` Ѝ@-@Ҫ0+ @0  G@Ѝ@-A@Ѝ/ DR /S@-@M :1S l0 0SЍ@Ѝ0 0C,   @@@0-  @@@0Bm@`0(MSp QS^R j1S l,0$Su l1Sr qP p@n  08 <0P (!* 000CP00i zz jRzz Php'  @0(Ѝ@`Ё ЍXS 0CS (Ѝ@`Ё Ѝ$ 7 0@e(Ѝ@`ЁЍQ Q0 00) @(Ѝ@`Ё Ѝl4PUT EP 00@'0 @1x 1 1 zzzp@' @=  z   P,   @@@0-  @@@0 >0@@ z  >b0> 0@@2,zDP 0?#@m@P MR 1 0@ R6 PЍ@ЍS S7P 0(0Ѝ@ ЍS#) (0@'0 @7F 0Ѝ@ Ѝ" (?0@@@-@Ѝ:P7S: 1@-@ 0@ MR(  |P R dP  Ѝ@Ѝ`d0@' @0 77 R0 0`d?0@@7/0@-MS Ѝ@Ѝ1@ 0@ R 6P `0@'0 @u>`?0@@ui0S /@-@@ЍP@-  1S @Ѝl,   @@@0-  @@@0-P M  1S z lz ЍH,   @@@0-  @@@0zDAm@` M0S3 :!R7 1l`P 0@ R8 P 0 0 Ƞ<4\/  @0Ѝ@` Ѝw<”?0@' @ 77,   @@@0@-  @@@08<”?0@@+ @-@ @P@Ѝ@Ѝq0 X /0 X `/Am@P` hP @dh@` ЍX@-@@Pdĥ@Ѝ@-@ @s\00\0@Ѝ@-@ @e\00\0@Ѝ@-@  0X0`@Ѝ@-@ @ЍAmP @` `Ms@0|@0*@4>@> @ 0T 0Ѝ@` ЍAm P`Op J` EP. @@p@> 0@ N`4$@ @ЍAm P`'p "` P. @@H@> 0@N*`4$@@ЍAm` @ MP` P>P 0@$@0@ Ѝ@` ЍAm P`p ` P.@ @?> )0@@4$#L@XP @`Ѝo@-@  ῐ0P Xd@ |00@0@ @^ 0@ЍAm ``@MP @EP@ PJ |(lP@0@@D^@q A!1pp@@ X@1@T |20 0@< @@\ Ѝ@`Ѝ_  |00@0@ @^ 0u |00@0@ @^ 0gAm P@`  )P lP @x@` ЍAm P@`   P lP @Z@` ЍBm `PMP> 0@?P:  Q8 |b00`@0@lJ@@tRl  @@@p R 0 0@@@^T 0S   0Ѝ@`ЁЍ-  @@@0@- P> 0@>P  1S l@Ѝ,   @@@0-  @@@0@- cP> 0@>P  1S l@Ѝ,   @@@0-  @@@0~/AmP``@ :V |00@ 0@@`@^ Ѝ 0i@` Ѝ/BmP@`|r`0@@p@ T \0@  0 @S00B TX0S! |20 0@ @@\ 2h R |00@ 0@@^ 0$dQ@`ЁЍ |00@` 0@@^ 0X@ |00@<@0@ Ё@`^ 0 ЍBm0T"` @EᜠP@ M@@z  @@0 0Pp@| i@`@p"0 @" 0  @y"(0 @p(#0 0  @g"P0 @^<#X 0  @UP#x0 @L:864(2FZn& @& @'#'P%x%% %%-%~%{ Ѝ@`Ёء ЍBmH P`@@`M H 0DC00 pHD^`N n0Aɑ0 Y3 1:1\AWЍ@`ЁЍBmAP @@``p $MPXT IP!Xg AX= X R4 9PI$Ѝ@`Ёء Ѝ0S H0S005 RL !P@T P @`PX,@ @1P ZJ$ 基PYP 44Q(x(Hp0H 0#H0S 000%1SH0Sx`HH0@X,0 @v1 Xn0J 08c$c400s0 0 S 00000%1S"s H"[Pm $ṹf`0H0H< 0@X @v-`0@X,0 @1 I0`Pm< 0@X @P!H `<0@ 0 X,  @*0H 0 0 0 $j0S 00H 0L0Y00 0 Rf P 4@@X, @1P`<X @0@IIHP* $%#00S( :1S, l01S F000%1S tHH`<0@X @0  000,   @@@0o-  @@@0g<X @0@t0BmS`` )0@I 8"#L@@0 00Ss $pPYH1 0@X rP `"X,@ @2 P @P # 0#jz0  à|zzz z'z'zzzzgzz}<Ѝ@`Ёء Ѝ%0 I&r C  [ >H"x!H"H!$0$$"D# сI )@ (p R !0 @PU| P ``0P`@@jp>0@X,H @n2 P@ )@ (p R1 0@PUr P `@t0@X,0 @? d )@ (  BR )@ " R @@P 0<S@0<0@0 1 0@@TV P  H>0@@@00 X,  @$H )@ " Rh[ 񟗰|&!%#@!@!@!@!#@F )@ (p RQ1* 0@PPX UP `@0@X, @F2@~ )@ ( R)1 0@X 0PJ @IPyb 80#A Q<@f3 (< ඓ`0 R#2*4:420 )@ "  BR1 0@PU P . 9 @ ((p$! @ R $0P$0d ` (0, (0$@`0(0A$0(@, 0J2@X, @`FсI,`l< !X 0@@K @BP #80<@@P<@ڶ3 & < 03 0  0  0 0!0!0zj_0  # @ P 80<@ @ P< @ڶ& 0F<!0  S 0 06m1* 0@PPX :Pt `@0@X, @?2@c00`0(04 `$00@,$ >( X 0@,J@@4 V #80L \> #0@  8#0#<00#<S :1S l01S &L& e`<0@X,0 @22 s`@ 0@X,0 @? a!DD Nl 0C@ gl DD BDD Bl `@Y= 0@@X ?@`K<= 0@X 2@\`p=0``@@p> p X 0@@n`@;`@&= 0@@X F@`@t= 0@@X @`@  = 0@@X @W&0  000V H>X 0@@ ,   @@@0Dl t-  @@@00AmPS`` &0$M 0@Sc 0 Sq @TT@@ 01I I@I ##L@@000S\ 1` 0@pXD P* @|P # 0#zEj0   à|z'z'zzzzgzz$Ѝ@`ЁЍ`n0@X,0 @~2 pM1I`Y> X 0@~@1I @FAm``pMjPP 0@!S AS S PЍ@`ЁЍ0S 00 ^0P0P00 R00P 0 00 PAmQ`1000 MM@@00D0P . @P_`P D ڍЍ@` ЍAmP U` O`@@B@ PP UP@` ЍAmP@` p{MMWE ,(`y0 0'pPd ?0@ $(1,0 0 S   0 P0S `F% P5%5 P< {ލЍ@`Ѝ'(`300 P0F N7S8O?S/noHS/ @! R qr/S1 0@ R, P 0@< 0 @/1@ p1 0@ R dP L < @ @pU1 ?< 0@@/pL0 < 0@@U@-@ M@ @"P 1 0@ R ,P Ѝ@Ѝ < @@ @00 < 0@@^-M0  @0"P 1 0@ R P Ѝ 0@< 0 @0 Ѝ0 < 0@@2AmP`0` M @MP:0@P4@Pq Q2 ,H  P0   X0p@10SP P0 10S0S2ڍЍ@`ЁЍ'0 PR x USr_qR n X0p@10S PP`0 10S_^*  |@%r  PpU1 0@ R RP 0@@<  @ 00 < 0@@Am@`p@4M  D`VPr$0h`PV`VapV V * @0`4Ѝ@`ЁЍ ?0@z14zzwz(P 1 0@ Rl P\aV1 !S=S8 c `@X  (`P011 0@ RO P 4 ,! @- @(1 )0@\*`+,  < 0 @ ` D1S1 0@ R= P h 0@< 0 @0+@ < `@ @0 @1 < 0@@41 , (0@@)+`P*,-1 0@< `@uh1 < 0@@nPAm`Mh  1Sl Ql@` P@ $0Rhp< >P /  @@1 W 0@ ’0@<  @ 01P0 RD P#Ѝ@`Ѝ@Ѝ@`Ѝ1 @0@W @ 1 < 0@@<  0@< 0 @n?,   @@@0-  @@@0 2 < 0@@n@-@MP?0@Ѝ@Ѝ1 0@ R PЍ@Ѝ4 0@< 0 @1C42 < 0@@AmhA @@``PpU  wP 0K`00@`Ѝx `@8 < @@PPPh `@ AmhQ P@``@pT  CP0 @`Ѝ 8 < @@@P@h @@`Ѝx @@-hA @@L +P L L<P 00@Ѝ H5F3ER-qML,MH5F3E L 0kL<PqݍЍ@- P@ЍAm@` qMM PF H5F3ERC00CSA BtP70 S:O? 0# !0r0P\ 0s0R' %0 B& $`SPSpSS3P Q Qp`0 qݍЍ@`ЍAm@` qMM &PS H5F3ER  0 ;PD0 RB  X 0 0CO ` % ?P !&"@#$@% & 0# 0q0 R\0 B0PqݍЍ@` Ѝ@-L@qM M L<P1 H5F3ER.00CS,( I P"2 S% ?O,$ 0# !0r0P\"0s0R003 S00 qݍЍ@Ѝ@m@qM M {P< H5F3ER  0 9;P-0 R+ "0 ,P?O4, 0 3 0#,0q0 RP0( I2 PqݍЍ@ЍAmhA @@0` MS R R Ѝ@` ЍPpIXI@IGPGGGXFO=3 0+>c P`PVDOO/  "$ ~ PV r Pz  PR zzgz*Rj* fzzzgQzT R zzgzzq t \ zzgz00000>2 0voC>1 0o00 |nO=3 ,0+Bc Pf`PUDOO/  "$ ~ PU r PQTz  PR zzgz*RFj* fzzzgQzT R zzgz5zq t \ zzgz   002>2 0vo=1 0'n00 |yoz0S=;BmP@` qMMp -P H5F3ER  0L L<P0SU񟗲LhJLL]oP1,'0 0TjZjɠ0O Q zzfzFz%zGz  P㰰¡ p±¡S QzzjjzFz&zGz: S9ࣼ:š) s/O0:oZjjR/OqzzfzFz%zGz: S s0PUZqjjɠ AO zzfzFz%zGz: S s0T`O\?  0# 0q0 R\0E  0PXqݍЍ@`Ёء ЍO]>c,P3,+Bf4Pn*|y` \o2,vZBDAmhA @@`M\ 0S S Ѝ@`ЍP#OOOOP|ONMMQ ̌+rbQ ΌvoQjΌ!͌ n0Q`PUDOO? 0#$0p0QU0s0Q0Uuj5 @ 0开`fz4A᷀` 00@zzgzzzgz0Szzgzz0 0^zzgz00000}Q|!Όό EoQ ̌.+vbQ ΌvoQq kΌioQ|όό Fo0Q_`PUDOO? 0#$0p0QU0s0Qg0Uuej5@0封afz4A᷀` 00@zzgzzzgz 0SzzgzBz00^zzgz00 00 00 00 { \Ό ioC͌  vof͌ $+vbC͌ voe͌ 8+rb;AmP ``qMM@ P H5F3ER  0L L<P0SU@U`UURV lrr.`#+vR0 06zzjj55 50z!%10  05  Fz޼0 &zG z: S9ࣶ1ơ) s/O01zzjjzFz&zGz: S9ࣸ1ơ) s/O01Zjjɠ OzzfzFz%zGz: S s0RuZjjO zzfzFz%zGz: S s0RpO\?  0# 0q0 R\0F  0+UV- oE |F_eV+ kn~`!i_\V n`"v_SqݍЍ@`ЁЍfmrr$` #+vRDCm ` "v_=3nE |F_7n~` !i_0DBm@P< 8 `@@p Mٿ`PV [0P0HU"㨓 㤳 P @@@ ' *  @U  0'P0DW@?UW1 0@NkЍ@`Ёء Ѝ @ 0 @0˿T|@0x @0忿H0h @0巿AmhA @@` P 8PP߿`P@ ЍP5 0@/@mP@ M:a?SJ1S- l 0! 0CS%  @1 Ѝ@ЍپP  0R, S S SR RJ!R l !-  @@@0lR R RJ1S l01 J1S l01  BR5 0@!Pp @0S Am@` PPpA @@_`=V00@` Ѝ/AmP T` 广 @@P AP@@@` Ѝta P ~70/@m@ MPP= T9@D T3[[[[[[\[ \t[$00 Ѝ@Ѝ P"0000000000002020Am@`` MdPP! T1@D T+\\\\] ]$]]]\$`tЍ@` Ѝ P `P `````bbAmP`@` $P UU UyP@1 @` ЍAm@`P` P TT T@y R !ؾ@@` Ѝ@ @@AmP` M`P( g@  >P  @mx0P 0  000Ѝ@` Ѝ @ @?I@-@P20@Ѝ@-@P$00@Ѝ3P P 8PQ 87 Q0@  @/P 3P P @/?P @/ @/ @Am@`MiPP ̽P   p @`gpk`oswxsЍ@`Ѝ/@-D@ЍAm@`Pp`Ph @(/*@`ЍAm@`Pp`߾P0S 7 0@0@`Ѝ7 0@ 0Am@`P` 忾P7 0@0@` Ѝ1Bm@ 0@`P`p ,MXF qP%᛾PX@ؼX @Ѽ 0 @ḽῼẼ,Ѝ@`Ёء ЍX@㶼X @导\0@( 0 @C0 Ͻ X@$ 噼X @咼$ \4C0@ @  ^ 0Am`S/ :1S3 l@`pP 0᧻ 0`0y0  @ 00g@!0 @@@`Ѝ,   @@@0ㇽ-  @@@0/ 0Am`S :1S! lp@P5` 0] 0 @Pz@`Ѝ,   @@@0P-  @@@0H 0Am`S :1S l`@pP 0 )@"0 @@`Ѝ@,   @@@0-  @@@0 0Am`S% :1S) l@`p Pļ 0  0`! @ @`Ѝ,   @@@0߼-  @@@0׼Am$H @@` P@` Ѝ0@mMSB @<  BPPUP 1 0@ RF PPЍ@Ѝ1 0@@T* P 儺 0@( 0 @0y 0@( 0 @0"Pk@.  @@@0t۽^8   0@@8  P0@@PBm@``T DMb TNpVp @@P( ,P < @<@8 @T  B  xPx;[c 80#<L ^@B 3<X03C X'1 0@ R YP|  `2@@ 1 0@ R| HP_@8   0@@@ w$p g@[k #80<L ^Dl D B0C@һ7庹 9   0@@\@Q@vTDЍ@`Ёء Ѝ<@t1 0@@T P 哹  0@( 0 @0㈻ 0@( 0 @0| 0@( 0 @0pv8  @0@@T 8  0@@cTBmP`@(M4.(Ѝ@`ЁЍP d$0U \    <Q 0@0 R 0\@.  @@@02403/,03/ 2P$0pU7 `@ @0V`  B 忹 W$0S  0@8 BmP0@`pA( Mɸ`P59pPJ0@  TO`PO8@Ჸ`P8 @ @ᢹ(d= @0@  pP夸3`P`8Ѝ@`Ёء Ѝ1 0@@TO P 喸< 0@( 0 @1"㋺1 0@Y PPJq\嗺D p\呺0\0区00jd9 P 0@@@ ٻ\d 0@( 0 @1" @PȻK<9   0@@`Am`pQAT`P@`\L\pGp@`Ѝ| @|  @AmX; 0@ @`+  @P`a M@p @V04p @Ѝ@` ЍBm@`QMO Q) Z P@| RX; 0@ ^@ P屸p| @㬸`| @㧸+ 0p @ @P p`X; * a0@ @P| @V p@@`剸+ p p @0P @@ܺp @Ѝ@`ЁЍ Z 0P@| @ X; 0@^ pP`cx @@p + p0 @` P @宺^pP `Ix @@` + p0 @P  @@ @ @呺^@ Pp*`| @%+ 0p @p @P `w> @mR0@#A!<$0\ rvvvwwww8w8w8w8w8w8w8w8wpwpwpwwwwwwwwwwwvpvpv> 0@ 0SN  \ \w @Ѝ> 0@ 0S9 APQwR ,A@. w\ \N ,Q@@  AQP  w ,@ A QPw ,@ w Q w0S S 0/0 00/0S S |*  @0h/ |: 0@0h/ P/0S S CP/ 0 P/0S S Co/  @o/ 0S@oC0SA0S00 R000D0/@0D0/B0D0/AmPwO`skyo@T 00@ B D 0`0A0C0@Ѝ@m@0MSezzz(z4zzz(z Ѝ@Ѝo01(RPP  )  !P M +U.A0101(R9 R  R3 8S4 51@ 0r c410!0 1P  0 1P ). 3#e01)^P >@ M.   @@@0ܷf &ꄞP01 @m01M@1P 0@ R PЍ@Ѝ . @@ @0!㡷>  P@0@> @m01M@  P 1P 0@ R ݸPЍ@Ѝ^ . @@ @0!k?  P@0@ 01/AmZf<`$M$Ѝ@`Ѝ>@`!`!P lV1 0@ R=  㙸P T . `@ @0 .0 ,20Y <S 1 0@ R  xP  0@. 0 @ 0 0 ,00?  0@@㩶T?  0@@㢶 0dS  /0rSP01/AmZ~<`$M$Ѝ@`ЁЍ7@dS p `- >؀0!!ᇝPBX1 0@ Rf  P T . @ @C? 㰶0 ,20o 7rSp`g`Vpf1 0@ R.  P  0@. 0 @ A?ㅶ<S 1 0@ R  طP  0@. 0 @ 1l0 ,00?  0@@A ?  0@@T?  0@@C  @- @CP # 0#@ЍAmP` @pC M ` @@ 0 @P`[Ѝ@` ЍAm`QM8@0 CR1ڶ#^C@ #   C C C^/ <  B CЍ@`Ѝ$8@ 0B S'ڶ0B 0@ p`@P@ 0pB ` P@0B#P<@D0, 0L@D BL @@.  @@@0#PAm8@@P`M 0ESPڶ`E0`@` E  E 0 E0E> 0@QPp1E 0@(!p W PЍ@`Ѝr` U @c0 0@'H @0 ᆵᬶ` U @O0  `0@@#D0`QP>PU] ԱPv ᚱ 0@'0 @3eg @ήiqbcPUW 㴱PV z. Pd @ @㒛)'D4P @ =?c<2  0@@ۯw :M-P ۇL3  0@@įA3  0@@㹯6 0@'0 @3' d@3  0@㑛)D @㗯3  0@@㌯ 2  0@@はnc BmP@`ap `@MMX #Pi \w <0 0C0Cⷰ P,p @㎯u0, @P ,@ 1,S - R 00X0 PZ(1T D0S Q @T{ ٰP9#{ލЍ@`ЁЍ0?s X:1p*74 0@P帯P_ 4 0@' @0F>J \@.  @@@0Pe 0@'0 @40V '@ @= @4 0@/< 4  0@F@㴮G @tjq(4  0@@㠮}5 0@ @T# IP $ 0@'0 @4 ٮ_4  0@@s>$5  0@@hc Am@H P@` 200@` Ѝ  @-@@ 坭0P <@ @<Ѝ@@Ѝ s+@m0@@ M 0R A RN ܡD|D0 Qʀ *1l;4|>04  0(Ѝ@Ѝ)@T Q0  0$!R001 0!1S  ʃ!l+ 0!l+1S  ! 0!1P 0@@T ㈯P 0 @X 0@'0 @5  0PX5  P0@@㲭 0BmA0 @@`Pp` MMY RPU \c <0  0C0CP0S& P0W @T~ 2P  0@'0 @$5íލЍ@`Ёء Ѝ0SY @T  P Ѯ 0@'0 @F5㜭®5 0@' @05፭ \@.  @@@0㓭 R1 Q. Q+ \( L^e \b\w@T  ǮP3 ፮l 0@'0 @45X$~5  0@$@@T/ 㥮P k 0@'0 @*5 25mU5  0@@ͬ15 0@/ X@6  0@*P@㶬@T eP +@ 0@'0 @/5 0S LP  0@'0 @75ݬH0 0JJ I 0 SS$ 6  0@F@i0 @㚬  ၭ 00 pP[H 0@00S (R$2Sv ". Rr 0 @0A 0S 0@ 0R 嗭P @T# P ᩭ 0@@'0 @t5  o @٪nᎭ@6  0@/@)ჭl6  0@4@@T 㪭P p '@ @R5 << @㦪kq:rZ6 0@ 7@ҫA0S0S ~P DA0S@`` 0@'0 @}5 `H0S 0S ]P|0SX UP l30@' @ 578 0@P<Pf ፬PM P Q* 8P& @Tr "P @T 0@'0 @b5寫 @qҬ7  0@R@Jcl30@@ BῬA0S@``i8 0@}`@.|0 I48 0@'J @ = qs`48 I0@@J P` fኬ7 @ 0@t@ z`(T7  @0@b @c 1- M 0@ R ᗬP P8 0@' @ 7,tL @ど\< @}, @y ЍP8 0@@c @m P@ 0P@@Ѝ Q@-@MA Q6 *Q   QE0S0SFTB 00Ѝ@ЍQ > 0@Ѝ@ЍPT) 00QP <Ѝ@Ѝ0S> 0@@ P   R> 0@ ! T00M/ @t0BmP`PU !M M9 a@ `@pW PPD0 |pP  \ <0Hh 0C0CtP8 /0@ Z F?ⰰ[8 /0@  !ݍ Ѝ@`Ёء Ѝ   @H@P  <0@ 0 <0@ 00CS00$00\& Pc @F L (,00CS񟗭<̴dXL̴̴̴̴̴̴̴8̴(̴̴H̴̴̴̺P̴̴̴̴̴X̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴̴ͪP 3< 0C B3< PU ڪPf8@0 CRڶ#C@ #C Y38x0@ P BQڶB@0B坪8@0 CRvڶ# CD@ # CCCuP@Tu 㛪Po \x8 0@' @0a3(+0P$0C?o20S0 0.  @#!<$00Pݧ< 0@'0 @?"@T XP  '@ @e3Dx8  0@a@ㆨU 0 妧0 <9 0@@ tP@.  @@@0Ԩ#D00 l  D0D N0A@#PD0<`, 0N@D BL ߤkl 0@' @ 0?㻤0 A^'0 340<  008<0'  BR=ڶ#< ##8<0L\gڶ#<4 #  *8<0  BRڶ#< #*8<0  BRڶ#< ##8<0N^Iڶ# < #  *8<0  BRڶ#< #*8<0  BRڶ#< #*8<0  BRڶ#< ##8<0L\ڶ#"< #  #8<0L\ڶ#< ##8<0L\ڶ##< #  #80<L\ڶ3 <03 I0 A^Z0 3:<   #8<00CS,0 l D0D B0H@ۣl9  0@@g[8  0l D0D BL\(ڶ3 <03 #80<N^ ڶ3@$<03 !8 D0l A@0LD B┣PDl D BỤ0 @ ャDl D B0C@v  D0l  D Hy D0D Ll k PD0l D N`D0l b PD0l D ND0l D BUD0l L 00`Dl D0l 5Q@-@M< Q1 (Q   QA0S0SBT> 00Ѝ@ЍQ > 0@Ѝ@ЍPT' 00QP<0S> 0@@ P   R> 0@ ! $T00M/ @t0BmAP @@``p M MW P: \H <0p(pp 0C0C⇣PELYN $0 0sP 0iP P@ U T ţPT 0 ލ Ѝ@`Ёء Ѝ~9 0@' @05I \@.  @@@0O@T 㖣P8@T ㊣P P '@ @=C '@ @56P @٠@  @Ԡ@ 'P@ @5 @9  0@@㕡XTJ EP  @ @㮠 '@@ @5 ҡ o$k` @㕠P  @㐠@:  `0@P@^Oۢ9  0@@SsТ9  0@@HhŢ` @h :  `0@@7c 1AmP 0@`@p`MMW( ڢP0 \> <0 0C0CnP;0 _pPA 0 UPP: 0S: S  S  WPލЍ@`ЍoX: 0@' @07: \@.  @@@0@0 $P p: /0@%P4S N. R0`0$R O>00S011040P0 5S , R0?245S S. R # # # # $ $ $ $04\Q" U>00S 0T P# T #T 0S0 R# T  T 0Sd%R V>0S 0?1040?1040X0|5S W. R0Y07 0@ @P;-E BPĠ @@iP @@- 5S , R0?25S Q. R$5S R. Rn^7 0@ @崠P<Pu|X:  0@@5S Q. R0?3,X R>00SNX ;0 S7 0@ @傠P P᧡#P Pᜡ 4  0# S+< )S8;0S4 #+    0 0 4Ȟ Ğ03;0;0003* *dT0:T0Pq03;00c BmP`

1 0@PU TP | 0@' @7 @.  @@@0pP 44`S 0,0<4S[ P_uP\4SVF , dᘀ pWr pP44S <4S \4Sr wh @㲞; h0@p' @pe7 叞$ 崟 PA ; z0@$@$ $ 0S{ ӟPp ,幜 '@` @Y7p P_ᅟ|;  0@@m : 0@  : 0@ h; 0@@  eߝ#80<L\Kڶ3z <03 |0,Q#80<L\*ڶ3%$~<03 Pb#80<L\Pڶ3 <03 ,00L,C;  0@Yp!@㘝<PDl 0CD B@PPc Bm@`T Mp <0pPC^\<  0@U`` RL RIVd C X R3 RH^f X*0S1 0@ X P0@ 0C0JS 3< 00Cs0S@0iS SDSn GS ASSV@@T@ Ѝ@`ЁЍt<  0@@28= 0@ @'-@.  @@@0n@.  @@@0fX P`  @ H= `0@ E@S S tSb ; P= 0@  -@@$ P B@>0S <` `F`Ff 0@'0 @ 6 `V$0S <` `F`FL=  0@ `@㐜?P 0S[ @T/@Oa@ `@X *PO0 P 0 P 0SL P %70@ @P&@!@ @㯜 < 0@@TZ\X P`000.  @ ! $s@᠝= 0@'0 @5k`VP ÝP ቝ= 0@' @0Z>T t@@RP < 0@E@d=  0@@ܛh5@'  @@@57L< 0@'0 @ 6==  0@Z@㵛2<  0@ @㪛y@mSO@ 0PP@P@@@@@  @@ P0000@Ѝ@Ѝ@ 0@  @@@@00@ 0@@@ 00000Am@` P H01ZP A00^> @̠ 0@` @ @00P@ Ѝ0C00 /0! %@mM R\PP.\  \)  R. J @= LĠ S̈́ 1 0@ R 㤜P ͔? 0@  @ <9Ѝ@ЍgfFBaB?  0@@ΚBm@P0``  M000=Pp 0p 0 00  .P  (P#  !P  P  P 0 00pЍ@`Ёء Ѝ0 00p嗙4哙|$ Bm @`Mי@P Lxx@Z.>, ( 0@,@`-< p@0@0  0 ,岍m = = pT0`  @4  @㔘 0`  @4  @㈘0 Zh  `0 @<  @u 0@lG 0@̈́℀ ∠ጐp琀` ` `  |l,P0( : ,!xP Ѝ@`ЁЍ X  @@@%10L @@ᇘ00S (P 0Q0Q 0S/=BmJ`0`pPp==m 孙P [)0 ==d̈́^9n.0/00  &>帯 ⴯K/p?`>@-D-2`/M }p }@`ژ"-<ͅ$0嬏\ 0 L>P>=  8> 0@>\IPY 唙 吙 匙 则 儙 候 |?0(>P7k( `@ R6 = X$0d?h?Pp2 = ,<0|??P/ =.\40 P^h @̈́==^ ^//P#!<8<.DH>@`ЁЍ@ߙ00   @@@18   @@@10   @@@1(̮1@-@ 0@ MR dP  0@ 0 @1,0 0@  IЍ@Ѝ0  0@@㌘Q@-.P | 0 R 0S > @Ѝ0@000P@g/fFC b! CAmJP=``1 0@pW' ̙P 0X 0͔@ 0 @? X] p  0  0H60 ͔  0@@Bm``JE} ,M00Wp -$0?2cRR=S0A8ȏh0=QP>  @@ <  Lr M'  㖗ῖ  @ 0\ @! -P0 B0pZڠ   0@R0 @.  @@@0ޗ0S F:S p,Ѝ@`Ёء Ѝ  ΘR0$0$0 QY$0pS ėPP  =0C=嵘9$0S0S <  B=0S A1/^. ,/@m@P M)R*(R *0BS^P Ѝ@ЍTP R )R 7R7 R0S; !S ?@o0BS5P R R R 1 0@PU$ xP 41 P0@  @PPr3 (R0S !S S    41  @0@r ᗖ0 S S S /}S :S/0S0S QS XS PS@o(1*,! R :-̀- R -,0 s;? Q  R P> 0@"  //BmP`p( M⟗P1 0@ @T P^KЍ@`Ёء ЍW)@'`Vk ՗PP :{Km隈 Mj!*` sKskOo T5 P P PFp0SF@Ta 㭗P g1 0@  @ 3 p=Wd1 0@  @ ?.^3Z.4S0.4`?t!W@ @l1 0@ p0@  @03)l1W0@t@ 1  0@@㥕d1  @ 0@㚕^g 1  @ 0@㎕[Am@(`(` PPZ P@ D(PP P }0 0@` Ѝ> 0@* Bm` @ Mڔ@Pa D@@`1 ( @P ( 0, @ P㘭 0 `` @ @- @0 @`0 ``pt`j : j 0@j圀 0P M0 B vuB0 PE MoU Ѝ@`Ёء ЍAmP\` P 0\04P 040MZ@_`P `sKOT@` ЍBm; `!|0@$p @ M0   8P' 0@ B D 8 A0C0ԡRq w_@8 i  @gTPs{X Ѝ@`Ёء Ѝ + ,  @@@f0 + 8  @@@u0Bmd; `T{ m0@8`骀p@ M0Y sK @@Y<P .< T 'sko V Ѝ@`Ёء Ѝt+  Bm @`@ MÓP :@@0`p͔0 0 @P<@ ` 04@ 哒p 0  d [ P  `0  @P@ 0\@ !lwp  @0  <` D pF0F( ) @*q_∉+,徒 \ 0V L V0   @DfTPskZo 0S -: }Π-  !  = 0 Ѝ@`Ёء Ѝ(100:-R=-, S Q 0Q 0S/0P@m M +  @ @0  @ Ѝ@Ѝ+ ; @ 0@@ @ @m< P M8@+  @ʌ0Pޔ Ѝ@Ѝl 1@m@ 0@PMU= P* ; 40@  ; \0@  0S H0S (1T( Ѝ@Ѝ P; #0@<1; 0@ +  @ 0c;  0@@ k /BmP`hu0̐ M0@`\%0\5Y! p晑P0 0! \YM/0  \50 0 0000Ѝ@`Ёء ЍP̀Am$0P` .-PPj@ C;N4$  L0 A A B NN C LLW @`$/ ЍɑAm4@P``MT 3S0  0\0%1%(\+:)\ 0LS& 3S< 0S84S  -!S Y"S S"S SچS/ 0!f\*\ :0LS1 0@ R Pfh0^0Ѝ@`Ѝc"S S9k"S SnSd  S q"S 1 0@ R( ғP 0 `P@-  @0>P ah0[0 !S b!!S7 1!S !S!00 Q"S ?a"S. ʖS 0!QpP1 0@X 㓓P?0^0= `0@-  @ P0# 0!A00' 0!a 0!i"SL j"Se 0!9"Sr %S 0!"SS "S~ 0!!S7 !S00 q`= 0@@卑M1 0@ RN :P ``= 0@-  @ 0ϑd008C 0! 0!g 0!~f 0!z00w 0!sd 0!oc 0!k00h 0!db 0!`00]00Z 0!V 0!RC 0!N``= 0@@01 0@ R= ݒP `= 0@-  @ 0r\  @`@< - @ @:1@ _+@\  @`p)>   0@:p@@`> 0@@P`= 0@@j0AmP@ @0``MpP 1 0@ Rb |P Ѝ@`ЍV#1 0@ RZ iP ` - @` @6 ``> 0@-  @ 6 p0 Fr &R$00 % ŕ%0Ņ1 0@@T 9P `? @0@-  @@6 pː`? @0@ ph`> @0@p]`> @0@ RAm0`@ MM- @eP<0Sf D Ra R   R   R" 0S007S ' R,d0S R   R   R   R   R   R   R   R  R R" 0S007S z. R0`P$Q \ P P R   R   "R  \  ;^7S y \ ,  P* R +  "R ,  \  0 < P:P;P< \ @ L PJPKPL \ P \ PZP[P\ \ ` l Pj Pk Pl \ p | \z P{ P|q Pm0 00ۍЍ@` ЍX R &  R '  R (  R )  R 6  R 7  R 8  R 9  R F R G R H R I R V R W  R X  R Y  R f  R g  R h  R i  R v  R w  R x 0S0y0 $  %  4  5  D  E  T  U  d e t 0u0 <2 D0SAmP``$M @P 0S$Ѝ@`Ѝ1 0@pW- lP@1 0@0S. aP D - @@ @1A Pp`? - p0@ @@01 `P@A`? 0@ P@D? `0@@P uRQ/AmP0@0``MpďP  \Ѝ@`Ѝ1 0@ R PO0^0 p`@@-  @U?@@  勎`? 0@@U)Am=`` `\ 0S@` Ѝ0@P00qP0J0@9 d490 S 0S/0Am@P00` OP : 4)r  4)@` ЍdRQ@-00E00 0B0C@Ѝ0 B CEAm@RP` M$ A\4 1 0@@Tw _PdЍ@` Ѝ\ `@ @Č?  0@-  @k7dAQ1 0@`V 9P; k[$` k $`ZP0` ZY04`@\  @㎌?   0@v@@]1 0@ R2  Pg `00 0@-  @ s7㞍g\ `` @h - @@ @v>B ግ`P\   @W?   0@@kP&d}`00 @0@sgsAmP_``T @M_P- 8@@0< BQ <@ ڶ#p@3@p #@`000Ѝ@`Ѝ✿#D0 0DP, @@D BD I Ѝ@`ЍAm@``pM`T P@_PK <W@000<@0 #80p@P0ڶ3  <03 p@08 CRڶ#C@  #C`CCPC000Ѝ@`ЍG#D0 `D=0@-  @ 930S0 p0@@ ъR2 ၌P  - @ @9"`D= 0@@嶊Dl 0CD B @@#D0  <0P`0CS000S. !  @tpPE 0Sq0Sk 1 0@XY P%0001@PCЍ@`ЁЍNt1  0@Q@y@@.  @@@0w`7 0@- 0 @a> V1 0@`V 㬉P t - @ @Q>?0 a-`1   0@a@ӇX1 0@X: }P `p 0@- 0 @W>  0 Pb@̆1 0@ R$ ZP L1 0@-  @ D>0 Po@㯆c`p师1   0@Wp@デL1 0@@D|0Am``MSO @P<< p @PP0LྈP 0SF tPC T!P@R@ >@T@j0 vFp9 lލ@`Ѝ1 0@`V2 P @0o1 - 0@ @P0%3 y@.  @@@0ょ @0d`2 $0@"} 1  0@% @0Am``MSQ @p<< P @pp0LAP\1SH dPE !R   B/o"`17Pލ@`Ѝ1 0@X1 xP  @0o @0h%1 - 0@ @p0K3 @.  @@@0 @0d 1  0@K @㈆(0Bm``S MMr @P<< p @P0P0LȇP+0S: 1 0@Xl P Dğ,2 - 0@ @P03 娆 @0hPލЍ@`Ёء Ѝ1 0@XW P @0o~P1S+ - R' 0SL S6Q j?0SQP$ß1 - 0@ @P03 `@.  @@@0i @0dGPkŸ,2  0@ @0 @h3PWTŸ1  0@ @مQ j?0S  @0eP~P{1!傲P@!1sPj:-,=  S@P_ MT @@`s[@0D0CS0S M@TskOo V0ZPAY0 #p80< AQ&ڶ#0 <00 #     $  (  "!.  5L 0GDl D B@D0C崅@0Am``MS @P<< p @PP0LPNdP >Jp1 0@W} R ׆PL @0=====)Xp ÆPS @̃2 -0@d堅4 I2I -1?, 1c!cs0Q`!0=d1bލ@`Ѝ1 0@`VP ᑆP @0o ` - p@ @3:$1 - 0@ @P03 >ds - P@ @?@.  @@@0]2  0@@㕄`2 0@@㎄m<1  0@ @や0 @dX0Bm`S M M` @P<< @PP0L໅PB<0S1 #R. J0 P(S 0(1V Xn Mj0@ EF? R0H)XP(8Y 1 0@@T PU @0drލ Ѝ@`Ёء Ѝ1 0@ RP ˅P" @0oZ1 0@ Rg ẅP ` - @P @H:N @0O>2 - @ @ 0`?:P:@.  @@@0C(X(  @@-  @z:`P `1 0@@?`彃hPx 1 0@ R; eP `2 0@-  @ j:hy`2 0@@H嗃IPc _p 0@ hOb0F0SP163 P`@0@ zxP`2 0@@jnp0Am` pMSMx @P<< @PP0L௄P@LQ6 l0S3 $0S0 H dPe$0l`@ ``FلVx@  0 @`@` .1 0@ RP ݄P/ލЍ@`ЁЍ 0d@a1 0@ R? P 0o@P - @ @=9 ` PM$P - @ @t9 ` P@@.  @@@0I0 h@'$P3 0@@t`ςD1 0@@=`Ă\0P  @$넼Bm0` `pSM  @P<< @ PP0LPD0S4 (R1 z @  R CPrPWZ 0K ,@: 偂F? RnG局P孀0@%JU88ʪ 0d@ލ@`ЁЍ1 0@ Ro P" 0o@ Rk P @ P@-  @):H @`@@兂 - @ @9 ` Px@.  @@@0あ `x3 0@- P @:c P R7 ᶃP ` - @P @:Jh,`x3 0@@Y1 0@@`ہ@3 P 0@@) `́_`3 0@@ÁꔼBmAP @@``pMW fPY0Sf <p< @pp0LPb1S \$  @Vpї> RsY @P0h` 8 @C qW \$  @5ᰗB? RB@T Pt0h` P @p!ލ@`ЁЍ4 0@-  @ 25㞁0S@.  @@@0㥁@Tx P'0` o{p pP⻍ P D @ P=0P , @qP - @ @p55 Tp4  0@2@Ce3 0@-  @ W5<|W2 0@-  @ E5.MI3  0@W@̀c>2 0@E@73 1  0@5 @㵀꨼0Bm`pS MM @P<< ` @P0P0LP2$1S P;  0@ U S?PA1 0@ R 6P | - @  @Z2"ˀ @0hލЍ@`Ёء Ѝ1 0@pW` P @0oDȟ1 - 0@ @P0? 址lQUS hQ P@Z R P[p PY YQl1$   0($ ,0u~4q~5pYQ R ÁP 5 0@- 0 @?U45Y:YQi Rx 㧁Pz  X 0@ 5-  @ 40 =6i@.  @@@0?>[ y#M?0 CAl0!0I)0! S"]\l`\ZZZZZZ\!01 @P9U01^ aPIY< Y Y  o^ x*01@7[= 0 CAl01001 0S0(18<9S T @P 0 (9B  zRY  1` 6^|4 P0@@Z^EA R  P 5, 0@-  @ 40z2$   @f~ @-  @b2   oN@ Pڱ 8 b}  ]}@ @ J ]q$   @5~4 0@-  @ g2 XsŸ1  0@ @~ @d<@T3 01[(y 9MR01 # @A~1 0@@T: ሀP0 $   @} - P@ @2 $   @}4 0@g@~$   @}4 b 0@ @ ~m,5 0@@z~%$   @}5  0@@~[ 0 CA41l~01701X5 0@@ s~5 0@@k~kP= 0 0  C@0]$   @} - @@ @2~$   @s}5  0@@C~@Bm @0 S ` MM`Y Pp<< @ pp0L~P%0SQ 1 0@ R. P ` - @p @>b~ 0OPRލЍ@`Ёء Ѝ1 0@ R P 0oP:`5 0@@} - @ @: `P.~@.  @@@07~1S ;  0@ Y S 0hP m|ppW@ |PU_  W㸧V0 Z @ @ R RP \[0 \ CL}0 |M|`5PP  U`z -PCm1 0@ RU !P `6 0@- p @:}Ÿ1 0@@`R}]!\5 @`7V\5} ~P $ `@ @f| - @ @: @ }+$ `@ @PS| - P@ @: w} dPf`6 0@@}M\5[   @;\5 KL}u`@$  @"|6   0@@@|$  @|@6 0@-   @4 4} A$  @{@6  0@@| 0`@$  @{6   0@@@|ԼBm@P`pt@MP!` @Y Z~PrT _@{P <X@000<@0*#80@Plڶ3 <03 p8p@0 CRvڶ#C~@  #C@CC`C000Ѝ@`Ё Ѝ#80NQAڶ3 <03 #80<<@PYڶ3..$.03< #80<@Pqڶ3!$<03 <`|6  0@-  @ z;x|}Dl 0CD B @}|`|6 0@z @|d#D0 <@0G, @pD BpGp`| Ѝ@`ЁЍ#@m@80<,M N^ڶ3P $#`PsTQ P Pr?!P|/oPv/Pp*495q0幇M1@ 0@ Rt 2{PdT _@xP5 8p@0< BQ <@ rڶ#p*@ #p@0001 0@ R( {P - @ @9 `@Pyo`ލ Ѝ@`Ѝ`@.  @@@0y1 0@@` y`q`8059`<7 0@-  @ 9by`<7 0@@y0 h@H@k`#D0 P, 0G@@D BD Qy0Bm ` MSM< u P@<< ` @@P@0L(zP5D1S ; @0@@T S0P hލЍ@`Ёء Ѝew0PL0%1 0@ RP [zP L0T - @ @0<4x1 0@pWx EzP0P o`V L0~* S!<0MPj 0S1 0@,0YE "zP @[<014@ 01 LD[x< :-,= @ S  00*LD !@ @$ $, @4 800*#/( D @ s@@p P 9@PTp 0S De`0嬀 S0D 0S ,0 R yP @ŕ[$ 0@ŅDD DCxvğ - @ @@.4 Kxe<*01-l]`L U>0S90pS00 XY00U(R Q"",4 l 00wP00B,0S R; wP , @8 0@ `-  @ ;Dv0O ._0S wP \8 0@-  @ ;,v0S wP L8 0@-  @ ;v R  qwP @`p 0@- 0 @;v0d 1 0@ R TwP  - @ @; `Qu0 o$8 0@-  @ ;u:(0-  @8 0@ ;u#88 0@-  @ ;u60$ SR000C @`7 0@-  @;u|20@-  @ ;u 0[: OT8 0pS L@T R[ vP ` - @@ @J<u0/ j@.  @@@0u@`7 0@@ug|2 0@@  u R vP ` - @@ @=<Mu$8 0@@ t\8 0@@ tL8 0@@ t88 0@@ t(0  @8 0@tr, 4@ -  @; u@`p8 0@@tIs7 0@ @t! 8 0@ 4 @  t$ 8 0@@  t-8ȟ1 0@@`tX&PM0S$0S<00 24 0RN0X \0PF0 *v(0S0I0Z0HH0@mHp 7 8@pT0@Z0  uP <0R3_ uPT _@sP? #80<@PPEUq<@PՕڶ3!$ P [HP600媥0@3`9 0@@Jr@Dl D B@F#D0 P&ލ@`Ѝ1 0@X8 EqP @0o1 - 0@ @`0g5 oh!l0 : p_on@.  @@@0o @d 1  0@g @No<AmP`M^C:`7SA @@- S A @@ R pP2Ѝ@`Ѝ0PE:P PA A @@R pW pPh0 R @TE pPЍ@`Ѝ`: 0@-  @ 5LoJp@#: 0@-  @6 @9oA @@`V> pP 0``:  0@-  @J5op:   0@p@n`: 0@@nz: 0@-  @ 5 n`p̴:  0@ p@nV:  0@ @n0n1@m@ 0@P MR -pP `; 0@-  @ 96n 'Ѝ@ Ѝ`; 0@@9[n1@m@ 0@P MR pP `0; 0@-  @ A6n 6Ѝ@ Ѝ^`0; 0@@A1n1@m@ 0@P MR oP `L; 0@-  @ I6nn 5Ѝ@ Ѝ4`L; 0@@Inʀ@mPǜM\$ 1@ 0@ R* oP `T+H; @0@Uh PP@0- 0 @n6 P5nЍ@ЍQЍ@ ЍЍ@ Ѝ `T;HU0@@PPh; 0@@nPm0Bm @`S MM Pp<< @`pp0LnPa|`V `?o2ZL59 1 0@PU DoP+ `P@ - p@ @7" mp`600L5W1 0@ R #oP ` - @p @7m 1S10$ R^ 1 0@PU oP!ލЍ@`Ёء Ѝ1 0@ R nPooሳ< 0@-  @ 7|m - @ @7 `Pom@.  @@@0xm1 0@ R nP ` - @` @7Qmd3,0S0 S 0*x4 00KkP~.; 0V B   x C   ) `_ ?P_0 SP?l#PQ& P0FD0s0S0Su (Rr 0L 1 0@ RU WnP `2 0@-  @ 7lOH`` ?;  0@ `@l#ڲ<  0@@zl-͟1 0@@`ol7`; 0@@fl`; 0@@]la 00(R !4 @ (8)8R nP 40, - @ @(0 `08l0S ,R 04 088$1S . R 04 7\Y 0{ ,p: lV? R40wdY 0} 0p: l> R4 0x(81S 0 p1R$0( ] 1$,, 0@@ 0P @@800< @LP`T;  0@ Y *S,0P 0hPh jpPUx nh5 Uz 5&x R 80 R  mmP \[0U\U CNk" p0Wj(0[,0PLP`T!>"Pq p@ RU >mP0 S D0S0 0S <S $1S >0004d006/7AP7/`P44)R0  80059 00CS  @3zZ gPPP\5[ ;\5 HL@k_uq10CSY        0 p@0Y$ lP R `V lP0S:SSw=`V lP.ӕPJ7SW -   @@@7Ik0 p@0 p@0 p@ p@ R lP0 L< 0@-  @ "7k0<i@0-  @ 4  k <H i @0@H j 0S *R 4 P'0Q7P$ .0 BC1 0@ Rq =lP `= 0@-  @ 7j &P_ 1 0@ R #lP `3 0@-  @ 8jhᳰ< 0@-  @ 7j@1`, 0@0P Ro kPj `6 0@-  @ N8j]1, 0@0P RM kPQ `L= 0@-  @ X8vjF P 1 0@ RO kP `2 0@-  @ /8\jPUY kP5 0hP?@D< 0@@i9< 0@-  @ 6-jZ E:90vP}aqz< 0@-  @ 7 j0S.`P6P`P `V [kP = 0@-  @ >iCPH P 0@`0$0hT @h \  @h l $0@-  @ n8`ikὯ<  0@@]iXᲯ<  0@@Ri^4 59`2 0@@Fi0` ,= @0@ڶ3 <03 `8@0 CR9ڶ#`C Pw@` #PCCCC@Ѝ@`Ёء $Ѝ > 0@-  @ 6g >  0@@TgDl D BA0C@ g@Dl D B@#D0  0@-  @: fD0CD Bl @f#D0  0@ p@fv Ѝ@`ЍBm@P` $M 0Qp P@*j R *W # R gP \ X0  @ V0@@0-  @=)fw$Ѝ@`Ёء $ЍMV 0* S sgP1w09 R bgP <\0 X 0@  V@@0-  @0> eT _@dP <V@0L00<@08 CRڶ#C@ #C CCC100 p@P R gP \0 X @0@ @V  ``0@- 0 @=Be$Ѝ@`Ёء Ѝ R fP0S :0R{ fP}  0@-  @= }ei<”l> 0@-  @ =reX0 V0@\ @ > 0@@ e9<”\0 V0@X @ ? 0@@de崰#80审 ⋡᎒NP]ڶ3 !I<03 @0Z- 0  @@@=Be\0 X @V0@@`` ? 0@@`dt 0@@p d 0@@d0D0CD B@l  @dAm@P` M 0S0 S)Q P@`V 'fPX` `0AS`PUw fP ᷪP卪 - `@ @h=" d00Ѝ@` Ѝ0Y  1 0@ R ePPdP6 Ѝ@` Ѝ-1 0@ R_ ePP <”H? 0@-  @P C=ndl? 0@-  @ \=`dʵPU\ eP?Ѝ@` Ѝ/- 0  @@@u=WdD`?  ` 0@h@c6?  0@\@ce<” - @P @G=P d<”H? 0@@CPc$ - `@ @o=d<”? 0@@GPck$0  0@o@cAmPP`M @`T( T Q1n 0@ @ T 8ePM[0@^y`V P b@TЍ@`ЍQ 1 0@ R eP `<•0 0@- 0 @=cЍ@`ЍE0D q p@P Xe dP fc  q p@P `V dPe Rq dPIIP @=Pr <•0 0@-  @ =,c @bq# @?pK3($ #00` -  @ 0> ,pai0 #380p>0$  Ͽ/ #80<AQkڶ3 _ZX<03 00f sx 8P< A^oʶ"4p P

_=`3 0@@`_3```p3  0@-  @JQ?_`3 0@-  @ U?_1 0@ R@ $aP @ @-  @;=`@@_@z^``p3   0@Q@N_`3 0@@UE_`2 0@@6<_'l D B@D0C_`2 0@@;(_Bm``P $M Q@$ PU) <00CSn R MR RS)000S 0'  @.P q p@Y, `P!0H*S\\\\\\R< ~RrS000Sa @'  @P + q p@Y \`P0sS wS pS R M`P| @0aP]R$Ѝ@`Ёء $Ѝ%00 Rp `R 1 0@0SU *`P0@ aP1 0@`V `P ]D - @ @?^$Ѝ@`Ёء $Ѝ1 0@ RF _P60@ `PW]$Ѝ@`Ёء ЍS9000S 0SS4$  @NP Q q p@Yc _P7P )P 0P] PPUP p-   @@@J0`^- |  @@@K0X^@.  @@@0P^$PP P~(P 0`_d4  0@-  @ |?"^ 0B]4  0@?@]``^d4  0@/@]/PP PHHo᪢` Rj K_P X HX` @\0 0@ 0@ #  @  0 3 l 0@ 0@-  @0<] P,Pf `XpPW _P 峣pp0  - @ @8 p]-PBpW2 ^P @0aP]P.P*%kP%jP! R ^P p 0@-  @ `0?e]w$P7 0@-  @ j0W]7 0@@j\PP 0`]d4  0@-  @ /07]: 04 0V\4 0@-  @ ?= "]1 0@`V= y^Pl ]D - @ @x? ]^`]d4  0@|@\1 0@ R$ T^P 3 0@-  @ P0\0@ oP[PP&P~1 0@`V  1^P$ ]D - @ @+0\6 0@-  @  0\ R ^P  0@-  @ `0?\P?pW ]P 0`pc]t4  0@-  @>\6P"P6 0@@  \  0@-  @ `0;0`\r1 0@0S ]Pj 6 0@-  @ 0L\`1 0@ R ]PV 4 0@-  @ g?8\L1 0@0S ]P 4 0@-  @ ?$\PZ 0 6 @;0@`[(0Sx R,  k]P HX  900P pW Z]P X0 \ `P0@ @HXɡ @-  @=" [P\D4  0@x@}['3 0@@Pv[/P\D4  0@+@f[ZD4  0@@[[ 0`\t4  0@ @N[ 4 0@@`C[HX :9 0`pe\H6  0@-  @?[`\0 X HX0@@   @@3  0@  l5 0@@[ 0`8\H6  0@ @[ p6 0@@`Za4 0@@ Z!4 0@@gZT6 0@@ ZLY Zo HXgwẅPUE P@%- 5   0@@Zr`PX0 \ HX0@@5   0@@Z.PX HX@\0 0@00 -0  @-  @= Z X ߠ\0 0@HX@-5 0@  @tZAP4 4P R \P `X0 \ 0@ @HX @- = @ ZNP`X0 \ HX0@@6 0@@  2b 3 0P0|bP@`@x : @\0@ X :  0@@ \X :  0@@ \X :  0@@ \X < 0@  : ( 0@@ \X L< 0@  Zq : T 0@@  \pX< $ 0@  :  0@@  \]X< 4 0@  :  0@@  \JX< D 0@  :  0@@  \7X= T 0@  : ( 0@@  \$XT= d 0@ v : `  0@@ \PPX= t 0@dЍ@`ЁЍ@-@ WM@Ѝ@-@ WJ@Ѝ@-@ WJ@Ѝ@- W9@Ѝ 0@Am@ P` W` W:,`@` ЍAm@P ` mWU:@ ` Ѝ.@-@ \WJ@Ѝ@-@ OWJ @ЍAm@ P` J?W :W 5W` @ Ѝ@-@ (W=@Ѝ@-@ WM@Ѝ@-@ WJ@Ѝ@-@ WJ@Ѝ@-@ VJ@Ѝ@-@ VJ@Ѝ@-@ VJ@Ѝ@-@ V@ЍAmP@ `p M`J΄Vd`|@0 0@@  @S 0V Ѝ@`ЍAmP`  M`pV@ VT  `|0@@$ 0@VV Ѝ@`Ѝ |00@p 0@ @^ 0V  |00@ 0@@^ 0Vt@z>@ @Am@ ` LVPpP q@` Ѝ |00@ 0@ @^ 0vV@- @,V0dS0BS0S?@ЍmS0S @-@J@Ѝ@-@J@Ѝ@-@@ЍAm@`  MU`P`pP 0%  0 Ѝ@`ЍbpP p|0@@  0@W VBmP`|0@ @M }opP% 0@( @ 圂@S 0 0Uᅃ 0 S 0 0U|T p`P@[Ѝ@`Ёء ЍAm @` UPCoP 0$  0@` Ѝ> 0@FoP @m @ McU> 0@00S P|0@@4 @UU Ѝ@ЍZ0 &0 Am P`@7Up 2U>` 0@ @*U8P$  |20 0@p  @@\ ZU@`Ѝv晾P |00@ 0@ @^ 0DU |00@X 0@ @^ 06UAm ``PT. @@P8 P0oS0mS 0lS0SJpL.P.T>$@_VpP J|20 0@P0 @TP@ T@`Ѝ JpT0PT> |00@ 0@@p^ 0T@-@0oS p@%VPJ0?@Ѝ0fS nS0SJ0?@Ѝ0fS0SJ?@ЍAm@PR` J_x@UP_ 0?@` Ѝ@-@@U0/o"@Ѝ:&.Am P`@ TP 0|2@<0@ @^ 0R@`ЁЍx" @ Q@P QP > NP0@"  @@@2R"  @@@?RAmP`@ MR` @_QpP @|0@@0 @TR Ѝ@`Ѝ BmP0`0p|bp@`@\M @0@tR 0< @@@@S00R eR P*@\BYR @ 0- \  S00JR!0]  @ 0- \  S006R !0I@-R v 0"@ @@S00^ R@RH` 04 @S00Ѝ@`Ё ЍR0Am@P `Mp `帗DPp0@ Q0S |20 0@< @@\ Q@Q$Ѝ@`Ѝ5x+ 0@ @@  QBm@`R Mڸ~ p@PtQ00 R? |00@ 0@@^ 0Q Ѝ@`Ёء Ѝ~ p@00S0$0 b=S` yZ_ s⇿} U=`S00 00 S>ZH  %Q=S |00@ 0@@^ 0XQBZ`  QP0 |00@ 0@@^ 0=Q.  @c&!$/P !\j$Pos[_"V}P =Sp$j Pos[_ U=pSbt Am@@` OPPUP@ 0S U0  0 UP0@` Ѝ"  @@@o:P"  @@@x:P$ @ R AmP@@` RP00   J1@` Ѝ0|" `S 00V0@d @ @PV @@P0 |20 0@@- @@\ P@ЍAmP``@ Q0P0@` Ѝ |00@ 0@@^ 0qPAm`pᄀ M*.lN`V) PQPP@TU P "20@  P,< @ 0@@ N Ѝ@`ЁЍ 0|2@0@ @^ 0+P0Am` S SP @0P, ܕ`ٕ0 @@@` Ѝ P@` Ѝ  5x+  0@ @8 @@` ЍOx 5 @0@   @0ꯕ 80Am@T&\V @P@``M0 \Pp啕d0P@ Op劕PJj"~O @|0@@ 0@TOЍ@`ЁЍp 0&@-  @ @ P @Ѝ @$  > @ 0@  @/P @-@@ NP P: / /@Ѝ"  @@@V9iOP @-@@MP P: / /@Ѝ"  @@@E9KOt AmP@` M@NTP 0S Tʰ D@@` Ѝ"  @@@:&O"  @@@:OAm P`Np N N 0 `PN>@ 0@ϴP P VsU> 0@ ! $T 9 w@`Ѝ0@" PAm P`@ N`0P \P( 0 00:>SN P) |00@(0@@^ 0N@` Ѝ |20 0@ @@\ N |20 0@ @@\ Nb}L |00@0@ @^ 0N@-@bP : N'@Ѝ@Ѝ@-@OP : N'@Ѝ@ЍAmP`` :@P H@OP kM,`$@X@OP0``0@ ЍmK0`@@` ЍAmP`` @P H@}OP`KM@@$@tOP  M!@` ЍM @` ЍnBm\&@``T0@  @$M|R0pP@p@0^   嵓  0 @\ M00S S~  0 S : 0@ 0p|Rp@P@\@M\  @yL 0 @S00M0S  0AS Z8P<P0p|L#p@@`40@ R0 - S30-0^0-Y3-\M 0X@\%S00M H'J7 0@\uM$ R9N7S |20 0@ @@\ dM 00p|p@@'@S00WM3 R ,#4@\ppJMxX7x 0@|@@0 W @^ : P0@@ 2M(: |0@@ )M8S )(@!M 0p|p@@<@R  M : 0@@ \M : 0@@㨐 (^@ @ @L8S : 0@@ PppL0(X7x 0@|`@@0 ^ @\` : 0@@ L0J0pJ: <0@`@ pL7S `0(@L 0`|r`@p@<@R  L7S : 0@@ \``L0' 0`|r`@p@: t0@@\ ~L@9p S": @0@P`D oL 0`|r`@p@: 0@@\ _L@9  : 0@@\ ``QLD90 | @@ S: h0@@P 0`|r`@p@;L : 0@@ \/L@9 : 0@@\ ``!LF90 | @@ S: h0@@P 0`|r`@p@ L : 0@@ \K@9 : { 0@@\ ``KE90 | @@ S: e h0@@P K49R 0`|r`@p@: 0@@\ ဇ儗@K : $40@@ @P K4: @ 0@@  \K4: ` 0@@ @ ^PK49 8F\: 0@@ K$Ѝ@`Ёء Ѝ0@@D0@@0@@`D0@@J0@@(: * 0@@ : 0@@ \``\K@WK* QNKr\!: 0@@ AKD0@@@TLB@I 0M @^pp'K0VII 4@KL0|@ S000@b ^N @ 0 Ka0Bm@ 0@` ,M$00( R <|b 0@0P㠳 01@@`@P@0=0@0 0 pS 00qJ R 0S00gJ 0zSe <@R  J .>x 0@\J.r 0@S00J .r 0@S00I$>S @R  I% - 0@ @@^ S00I&- 0@ @@^ S00I~ 0 @S00Iq 0( @S00I> 0S .>B0ਏrIȀ@/H0 @@IX\ @I <@R  I>S > R @/ld0c @@\I-= )R @\xI/R 0@S00mI/R 0@S00bIP @ X ?38  HP "H 0 @S00GI X?Sq?S ? SE R(@  4I 0.P @S00*I 0/d @S00 I 0/x @S00I먏p @dJP 0 @S00I/r 0@S00H=S @R  H 0@/S00H 0@/S00H 0 @/S00H 0@@S00 HL @H?S S d@R  H l?@ \ -H ?0@ \H  ?@\H  ?@\H <"= @0@@P\0 wH u}Z W] ر@ 0  S00cH R 0@S00XH 0@ S00OH 0 @ S00FH 0@@ S00=H) 0@ @`@^ S00.H 0x @S00%H 0@P \ Hup W. W,   @@@0H 0@/ @@S00Gw \@R  G;R@@  G T@R  G* $0 0 (0Ra @G,Ѝ@`Ёء ЍP @FF 0 @S00G~l@G)S8[P6>.Bm @`@` P MfGt`PA ,: P|"0 @@=@ U@ @PpG@G,`@|GL: tG0S `M_VMЍ@`Ёء Ѝ 0|2@ 0@@^ 0UG(GP, P!60(, A CF0   CR0 C(\FP((0"P\ @@ S5   Q$`02  0 00@@ | @X$GPj \(`0+ L P Bz +"  B B %  $ P@@`0"P @@$BmPQ`p@ F> 0@00 R2 0|2@H 0@@^ 0F@`ЁЍ丮 @00S ᄬjP=S@ ᛲ u=@T00 SjU`m RF:=S 0|2@` 0@@^ 0FnU`a 6FP 0|2@x 0@@^ 0iFU  FP0) 0|2@ 0@@^ 0RF> ㈙0@#\{P #<P ` ` P V 0S 00CS8/.  @ #,#!8/Z=S@ =@Ty @`Ё Ѝ;0@ $30@ BmP`pRڸ @@E00 R4 |00@ 0@@^ 0E@`ЁЍ与 @00Sp ᣫ`=S@ @⹱6=t@Tp00SᇫW` oE:=S |00@ 0@@^ 0EዱP z=S@@|=t@TBm@``0P|rP@p@  0@ v @EP 0P @S00E|r0Pp@5 P@ p 0 @\E- = ء\-  QР@ (D /@?\D 0L@l/S00D 0x@/S00D } 0 @\D 0#@ @@S00^ DB  8>@<\DL 0( @S00DT>S`/R 0|2@t0@@\0D]-[8 U- 6|4`00@@@p 0*a S 0 0lDV  0@dD R @]D <@R  UDP U U,   @@@0BD4` 00|r0@p@@ЦR  @ @P5DPU !EP 'D B 000@ @P \0DU[P |r000@p@@ЦR   D@@P: 5PUQ 00|"0@ @@\ C- @<Ѝ@`Ёء $Ѝ{B C B 000@ @\0CP% 0L @S00C0 00|"0@ @@\ CAm@R`` ^ P@00S @x"00S@` Ѝ PVC> 0@00 R |00@ 0@@^ 0CPAmPJ` `P @A{B`@ ЍAmPJ` `P @AfB`@ ЍAm@``pZP @AOB \ |20 0@p\ @ @4C@`ЍAmP`p`\@P U]@P @`Ѝ |00@(0@ @^ 0 C |00@L0@ @^ 0CBm0t'` @Iᜐz @P P M@@  @@0 0Pp@|B@' 0 @tmB' 0  @B', 0 @wB`@4( 0 @ᨱlB8(T0 @cBh(\ 0 @ZB(|0 @QB@>B40@@@?40@@? BmP``pM0@뜢Zw?PG@ 0  00C10 B!10A1s00s00;0+S>0%p @(-?뉡P 1 0@ RD \AP3 Q     " #p$`0Ѝ@`ЁЍ1 0@ RD 5AP $@ @1?0@$0 @B1?60@@B]?1 0@ R"  AP0: @??50@$ @ 31?50@@6?v50@@3,? 0AmP`@`S5 @ ~@ z@@@VX @  1R m0S@0S@@@0S@`Ѝ@@@ Q@`Ѝ@@` 0 pPVS@ )@}@ "@ `@Ѝ>m@$,  @@@S1?Bm@`P!0M0P4`p p>XP   Y   > P E+0Bpb1 00=V   p P@Ѝ@`ЁЍ=0Am@P` S @ ?0S @` Ѝ@@0S ? ? @` Ѝ?0Am@P` S ? ? ?0S @` Ѝ??0S ? q? @` Ѝi?Bm@P`p` tMJ `40@ x- x- 0S! !SCQ b bYG J>1a3;J *དྷ[T PXp G ]a-=Rc% PePNR h -=Ե\l0B l00p` +<tЍ@`Ёء Ѝd Pe1 0@ R E?P @6@0@$ @P2@=!0  0S  >|- @ @ X0$@( |-p P T A    RY$@ 000C?oQ20SA \ Z*[P 1 0@ $0R >Pw0P`D Dd XD0\0E00F0=0?G0=H0=I0p FH$002300S00S000S00S000S00S0 00S00S00++M+ @0 !L  PT0Y' 7'00@4 `(`,00 @@Xp8 < 1S  '><  0V#0  Y `04PX 0  L XYZ0`0,R;$ 0 0C0R 9>P 80< :3<Y$@.IXp!Y  @ \ @ 0      !0!0#0S $/"p0 t@ ;Y1pp[ 0@p W$0[ R =PX0@DD0p"0D0E0=0?F0=G0=H0FG002300S00S000S00S00p 0 W p  ;0p+G0Hh1 00%; L PTpYL  YQ R =PxXp\0 p0!Y! Y`0 0   `p0d ` 000 0dp 0@$0 @2;{h0:80<;60@@;k d0 0   d0RO ;=P?X 0 `@@6 0@@P@i;0@$0 @2;($p@ @?;{60@@K;60@@D;m$p@ @3 ;60@@2;$1@m@ 0@P  MR <P <0@$0 @E3m;0000 Ѝ@Ѝ<70@@E;  /*@-Y@ЍAmP*``P' @pf:@P 0p/` P000S,^ P@ R\@;00@`Ѝ /BmP`dw`@㧯 @Mp@0V @   t9 0V@ B ` V0S 1 0@ R O<P00Ѝ@`ЁЍt70@$  @3:t70@@}:PQ00Co//3P MP3 ZP@ gPM/Pg &P  P /@P&/Z//@-@@Pppppppppp@Ѝ@Ѝ0@ЍS J@ЍP'POP/P P3: P3: P3#O<Am>Dh ` MA\2cG  P`R0 R BoЍ@` Ѝ\< 3:\8  RW 1 0@@TC ;P% ``@H;(@ @@r0` &:!\ L\ R 1 0@@T4 s;P 4Co' @0``@;(@ @@[0``` ;8 0@r`@9' @0h0Co``:8 0@[`@~9Am@`P$M 0@`SLust@t$t$t$tLu@tO<h >D5P`p 7p0@ 00S $Ѝ@`ЁЍ0 '0J @fŃ p#3ScS1 0@X> :P `@:P_8 P0@( @ &1p@w9O<h >D5P`p p0 \00S0 '0J @fŃ p#3ScS`@c:P&8 0@@& @8t(BmP` W6`0@@(0 @2< F6p pW 0!S 0CS0<00E@`  d4Ln0 <d0@$Ql@. 5`PV}{: 0@YP@5`@:0@@g5p<`0@@P 54:`0@@T5E@;`0@@<5D0_s0 QPi4>>000@P04p@LPT\0S 0S 03<05:S 0<0 6P `0<@(0 @2 5@ `@002 ( @t5`:@0@@P50r((  @@@92l5`;<0@@4` <;0@@ 4Am@P` @` Ѝ@-@ /J403@Ѝ0Am`MS < P BR J`0x00H70Ss0P<   BIP; V 0S 4#3` EUv 0FY 0@D @9Di!V`Di 1 0@ R 86P0 HJj 0 0Ѝ@`ЁЍ000p # pVDy1 0@0S 6P ` (@` @]34 I49 8 0 @49 R"1SCqS59 5)S 1 0@ R 5P 5)X=`0@Dl@@R( @3 j4pJ#p!\! # ̓ RE H7`0SAJ70S0=0C:0@F0@C4?#` Tv 08F0@E` (@ @`_3#4JYH  @ ES2S Cr @QSSQ*7 R R R 6R`@.  @@@0 4R 5)f`= 0@@]3`=0@@_3`X=D Q0@@l=0@@x3Bm@`ap `@  MR\ 5PL0S/ 0(@@ P@0@PS#0S 5P d0 @ 3 0 d 330S, 4P |20@(.0 @e0v3Ѝ@`Ёء Ѝ0@(.0 @^0c3(>0@@^3|2(0@@ eЍ@`Ёء $Ѝ2AmP`p`MP 0S0\ R1 0S:1 0@@TF 40P'V0 Q 0S0 R 0PS:1 0@@T6 n4P00Ѝ@`Ѝs0s0H@@(.0 @@20l@@(.0 @@B20H>(0@@ 200l>(`0@@ |20RAmP` M`Q$ 1 0@ R 4P<Ѝ@` Ѝ1 0@ R  4P >0@(. @)020@\#0q@S0DS!1 0@ Rh 3P >0@(. @902>0@(. @  0s2UT UT UT  0 @ R#00ST 0T?000#200T 1<0"300S100 200"2 000 0|>(@0@1s>(P@0@1j>(@0@@1a $42@o/0@m$D& S<0=0@ P*PP@ P@002@Ѝ-Bm`p $M0@傗Q`ԡ0 2#80< AQ#ڶ3 `@< P p 03 0  p0!2 0Q2$Ѝ@`Ёء Ѝ l D B@D0C1Am0Q P@@ 0`MR`j 2P0P PUm 2P9Ѝ@`Ѝjz='R>: PWRd 2P ``(/@ @PV0l107:*`(/? @0@0L0L S1`@00@(/0 @P0 C1FD-Ϡ 707Ѝ@`Ѝ1:`p(L?@0@L0`@0? 0@P(@@0``?(0@@V0BmAP @@``p $MW I [2P1%V% 0 0.P z⁗YF R] F2P `0@(/0 @v00$Ѝ@`Ёء ЍJ7S07`pv0@(/0 @e0 `0`v? 0@e( `@P08  '8d偷>0P" R@ 1P 07`?(0@@v-0`(/@ @0x0g儇0᰷t 0R* 01P0D-,4 Ϡ0@ 7W0|`0(0@@/`P(/D͚@0  @0@ @0`P0D͚(0@@/@mAP @@M R6 1PO>P R2 z1P Ѝ@ ЍqЍ@Ѝ`p0@(/0 @00`0@(/0 @0/`p0(0@@/`0(0@@/@mQ@ P@M R7 51P: '=P R0 %1P  Ѝ@ Ѝ-`0@(/0 @0/`0@(/0 @0/`0(0@@B/`0(0@@9/1@-@ 0@ MR 0P `00@(/0 @0u/ .: 'Ѝ@Ѝ{-`01(0@@ /Am`z7MS Q` P@@ R4 0P" `.V၇Ѝ@`Ѝg=P R/ 0P Ѝ@`Ѝ`d0@(/0 @0/`d1(0@@.`(/@ @0/`1(0@@. 07/AmJ\` Q 0S -0\9@` Ѝ00P)P0\9\9Z@6 &  /o.\ - PAm`M P@ P` PmXPpЍ@`ЍR RP"  @@@v1.R "  @@@a1.RP"  @@@i1.RP"  @@@_?.R? "  @@@e1.1 0@@TS /P @;t"P@ @a? `U.1 0@pW, /P"  @@@1S."  @@@W?K."  @@@]1C. t@" @1b @".s3 `0@ @@-s2 `0@@a-R0Am@`X+   @@M<q@P`W 0 P-P`P \@X,`PЍ@`ЍAmP@`  P   @d/h U>`h l P5T5XU@ Ѝ0Am@ P0R0`4MF R3 R   @X-4Ѝ@`Ѝ:$4-8= $0( , 1 0@ RC .P(0` - + .(  -:,-0 <=$ (,0:@9 " 0":(-h3 `0@$"( @0,0` `_- h3$`0@@(,p`` p,0P : L'vU"@-  @@@A?O-@ ,Am\H`HH dM R#22c0B S^1` 0@@T {.P `"@ @P1-.d5 VЍ@` Ѝ`3@0@ ,\/1AmP 0@`@`MV` E.PCUP: :UZ,:\9S0 M @+0  @- Ѝ@`Ѝ-Z`-H +P +X HiPi+8 Xi|+8iy+g\9S +\ p+0\9Ѝ@`Ѝ@`pl+`@g+0@"0 @I? `, `@T+p@O+3 0@Ip@,0 RQ  /0@-@ R R  01S p@Ѝ Q   s\0Am@``MS? U^53 \0@,\y-0\0*>,0PX5PH08  B CX0C0SЍ@`ЍzP0崇g S PЍ@`Ѝ9L0S c 0S0S 1 0@@T% =-P q"@ @0+P  07Ѝ@`ЍP q4 0@@Z+*"4S1@mP 0@@ MR ,PЍ@Ѝg̓00"4/`<40@@P2+`<0@"0 @1 P{+0AmJ0`"TMU[ )0Eps0 0$ 0sS :." Q- 1VS- RR- VP-0V11 0@ R5 ,P `40@" @ 1 `P,+3#`Ѝ@`ЁЍV!- V - V-0Vy"x  @@@1+`40@@@ P*0!S AS S ///@-*rP@ЍBm\P@`U IM 1 0@ R /,PqPIߍ@`Ёء Ѝ`40@" @qP C2*: `p$(P\ z> @.S*P/ R +Ps>\9㱀0@D0T@Lਏ00 > R :0 d+ PP r  0S~ Y +P h`e(H"@ @]2  [*q x+P 0S +P q q K*P X +P6<&0 @Ad+0\``@nD60@   0+W`|"@ @P_2 *~`|50@@_)t`40@@CqP)6}+ ~'5 0@" @32) R M+P `0@"0 @f2)6/`0@U^t\&+0\0()0PLPX5A+'"@ @.2  )l`Ph'H5 0@]P@U)$+'5 0@.@G)Q+ ~'5 0@3p@9)S1 0@ R$ *P `"@ @N2z)5/`0@jP/t`50@@f)`40@@N)Am@P`p`\Mp' 'P0 T8\3?<0(PP 04Ѝ@`Ѝ1 0@ R3 *Pn `\"@ @p2 )n1 0@ R u*P `"@ @p2 P)`60@@P(`\6@0@(nAmPUN\` ?*0\0')0P`X5@ ЍX5Am@`pMS UnL'X50X5Ѝ@`ЍP! @`C R *P"000: )R(X5U*Un(P X50CX5q'X5U:`60@@`E(`0@"0 @2 `((1AmPJ:H1` S 0 `  Mx=|====@Ѝ(x=SL-S*ῶQ0 -d03L-S:-q=r s0!p᧶|d 3L-S::t-R M ( t @px-|---- M' @-(@Ѝ0Bm@ P``p QM@& &I :-\P J   @ M$U( 㤨 @@@(000@T , [  Ry K)P 0  '@T 0R ,005 ̨ @@@L@P  '0000P@S  ('(P R )P 0 ' 0 H'`? 0@#<`@ T (P((P 40@ T0C40((P Qߍ@`Ёء Ѝ 44w' 厓 0 'n= 3g'0S S Co/  P/ 0S@o!>Bm @ 0@ P0R(@` MU  (PD $9*0@ q0 -|0p&$A'0$0oJ4p ?']W$ 麅@`sKO[ $0SP `wsKO&4[PW Ѝ@`Ёء $Ѝ'0@(0 @ ,4&90@@,&AmP`@p(P PV'`( &P @`Ѝ(D  @@@4&i,(0 S @m@\@PM%P #80<L\ ڶ3@ < 03P@Ѝ@ЍCDl D B@0C@&>Am@ 0@P0<@` MTR $0S)$`P`Ѝ@` Ѝv (%1 0@ R.  'P 80@(0 @ 4I&0R0CS1 0@ R8  'P 0@(0 @ 4/&`$890@@%0R0CS1 0@ R  u'P h (@@ @4 &`$90@@%h90@@%Bm` @  0@P P P P Ѝ@Ѝ0> 0@N @@ 0> 0@N @@ , R#0> 0@N1 @@ 0!N @@ @@]0 43! 00 @/! /!/R\AmP@``pP @0 P@ "@`Ѝ/@ `ЍAm@ @`pM8P`Q+  #P0P, @0W   `    PЍ@`ЁЍ0@(0 @ 1 `P";p 0@`@P! Ѝ@`ЁЍBm@`p @ 4M\0X`Y`P(060606 07$0B  A#P'/PL @U0!00娰z 000+"02`+;  P4Ѝ@`Ёء $Ѝ; (e!T8(0@1"0@(0 @1 p` !T8(0@10,0",< 0@@`8! 4Ѝ@`Ёء ЍBm@`p8M₍T1 a `@ P␗ @ T0  !@0 !0Z  "P$ $  @( @  @0@(0 @*3 G!a G p `@oP婒UH  "P PP@! 0@$  @@@&PP8Ѝ@`ЁЍ`VE  x"P $  @t(@ @?3 P!$  @ G @< 0@*@ $ w @\< 0@6@ P 8P$ u @\(@ @63 $  @!t< 0@?@s Bm@` P 0@00(`V $<8, 0@ @00 $0@ * (P@8p07k@ ii # 0AK R"  !PW0`0(0V P0$0 @S3  A  S0 0@(0 @ {3$' t0P@( @ b3 <0@@b|(  @@@u3 0$0T<P0@@{0$0J8 Bm@``pM@P 08 `Ѝ@`ЁЍ6!0 S `~h,=`0@@GSp`Wy !W3 @W]V1 0@0S4  P! x=0@@H(3 @ `pW' W;VS1 0@0S  P`8Vf1 0@ R1  P x= 0@@H(3VB1 0@ R  P x=0@@H(31 0@ Rw  P H0@(0 @ 3`-V$1 0@ R  P x=p0@@H(? `NP > 0@P- >`> 0@pP\ a `@0S  V P0AS\  $d@`P  #80< AQXڶ#0< # p p   !0!0! 0 0$ P`K0-S@z20 x`>嵊P Q R   P- 0(@0 @2 ` Ry  P 0<(@0 @3> 0@dpP a `@ R  P = 0@ @ @Q3( @ [_P pW>  0@#|:'P pW  P  =]0@P@`RPd@0@(0 @3" *> 0@ P 0ptpV*1 0@ R  sP 0@(0 @ ?`> 0@`P1 0@ D R  UP3 `@( @3  @Psx=0@@H(3O1 0@ R  3P^ 0(@0 @3/1 0@ R  PK 0(@0 @3R  P; (@ @`3 `/1 0@0S  P$ 0(@0 @?1 0@ R  P 0(@0 @3 @@00@^@0 Rk `V5! * T80@㼪ᰐ10@(0 @2 FOtP` T80@㼪ᰀ1> 0@@6 `)?0@@`.  @!|$ppPQPU)  iP `b(@ @2  P X<  PP{ P=-0@ @`U PPbt0@(0 @3" c R  /PZ p(@ @2H1p0@@hJ0#0S  PU  P= `b0@(0 @? . ` @x=0@ @ `<`@x=0@@`/l D B@D0C Ri  P D0@(0 @ 2`f ` @x=0@ @ ` =]0@P@`RP+b@0 P0@@p`@x=0@@``@x=0@@`0`0@@`=0@@`0@@``=0@@`=0@@`zp>0@@`p`a> 0@@d `b>0@@`vY=0@@ `kN=0@@`aD =]0@P@`RPat0 P0@@N1`a? 0@@B%: Ao&`BmP @`p $MdT0QPXL@0(  P"0P( @0 `P @ $Ѝ@`Ёء $Ѝl0@(0 @ b2@Kl1` 0@@@ $Ѝ@`Ёء ЍO< >D0!aq0QS /@-@Rv0P @0@@Ѝ@Ѝ 0BmP`S_pP% !Lj@0$@o⾕ P sKPOT $0S,0S6bP00c0@`Ё Ѝc@ `ЁЍAmP@` MQ1 0@ RG  ,P3Ѝ@` Ѝ> 0@0<`V ``PC @P  _Ѝ@` Ѝ*1 0@@T'  P (`@ @q2 0@( 0 @j21@0@j*1@0@ q! !>Am @ 0@ @P0` MR(`#  P 0P& @0P@Ѝ@` ЍT8 @0@@1( @2 BT1@@0@@ Ѝ@` ЍAm@P  `` t0P @`0000P@` Ѝ@ ` ЍAm^" P@` @`TM#@P * \  @@0$H  L'P[`< 0@ PhpP#p  @1 0@ <@R:  2pP  0`@( @ 4pЍ@`Ѝ1 0@ R  P h(`@ @4 @h2p0@@E 20@@p;1 0@PU  P 00@(0 @4 xX@p pl02 0@@ Am^ P@0<@` T p @$0Si@0 < @` Ѝ> 0@0<P $P/Am@`` M$@PU !< @@0 0R<@0A  {P/#80<@LP>ڶPL-pU<|p:0 P3<  0P Ѝ@`Ѝ`0@$#0 @ /0`2$0@@/~ D0CD Bl @Dl 0CD B @@Am0Q P@@ 0`MR`k  P1P PUn  P:Ѝ@`Ѝjz=|'R?: Rg  P `0@$#0 @ P0Ѝ@`Ѝد:*`|$#03 @0@0F0L  f`@$T0@$#0 @J0 V@-Ϡ |70|7Ѝ@`Ѝ:`p|$F03@0@L`@T3 0@J$@@`3$0@@PBmZ@` QwMW 1` 0@ Rs  lP$Ѝ@`Ёء Ѝ0@S)1 0@PU  WP `@]0@$#0 @j0 Q0`@$#0 @ b0@ `a0 `@0Z  )Pn0pdpP70%P' R|  P `0@$#0 @ x0Ѝ@`Ёء $Ѝ`3$0@@b`< Ⲩ|wT R#  PP@-Ϡ 7xG0@t7Ѝ@`Ёء $Ѝ`@L]4 0@j$@@X`4@͙$0@@`4]@0@$#0 @o0 pH~`#]@4 0@o$@ pq`4$0@@x`4$#@͙0@ @00 #1@-@ 0@ MR  uP `0@$#0 @ 0 J0P7Ѝ@Ѝ`4$0@@@-@ J0P7@ЍAm` @MT 1P 0@ R6 `7P!Ѝ@` ЍT1 0@ R+ $P <0@0% @ 0200@0%0 @,0 P50@@0@,G<5@00@@2<000%1S :44S  AR 0/ R00C?o2/P0i4i4S 0i7/@-\R #\@cD 0 @8Ѝ@h%\ 4Ğ\ @AT d40Rʀ #0c$\ \ d40000%1S :44S 0A0C?o2/000%1S :44S  AR 0/0C P=3000#/000%1S/:4ē\/0AS/- M05 0@ V ЍAm@`p`,ML00%1S :4$R AQB V $ 0 PPB [$PHT0R !݁r 0 ͕r | 0 8vP 00000%QU Q:QY Q 1 0@ R  P^Pj,Ѝ@`ЁЍQW R R:IP1 0@ R P `d0@0%0 @0`|X:40SP :40SW  RQ  CSRb05 0@PIPZ40S( S 0 40Sd 05 0@QP`0 @0%0 @1^P@ - 0 0 054 0@X"P 0P0o S05 0@hPd`d500@@`Z05 0@UPQ:G405 0@JP C>0P H 00;05 0@6P2`500@@^Py'  %!R/*4$R/ AR/@-+PP @Ѝ@Ѝ0AmP`@`MAS+ Sb !SO,3h.D4"BbQ SЍ@`Ѝzc$R* 000%1SX 8*cdDp000%1S z4P  d4R R h$0D2c1R /Sc4S;1 0@@Tq P \ @`P @0%@ @1P B0S( O,h.DQ 240@"BbQ P4P 0AS c$Q Q0& SS@40@4O,x1h.D4"BbQz Sq0S S S@40@40S= 0c$h4qS!050@  E@4c$0@4c\ `` @5 0@0@`D@$h @$ R R9s :ZSc*0 Rs0d4* dD'}/050@  EDAmP` MUL <@AQ)`Aov`VI 1 0@ Rp P[ 0^?s01 <$@0% @LL ?Ѝ@` Ѝ1 0@ RB P7 ^ <0@0% @L 02_@.  @@@0g0SPPV1 0@ R( P L0%`@ @29PP500@@$60`@0@L60@0@Am@`MTz nDL LL"*b"b3##2P0#31BT 1p 0@` R  P$Ѝ@`Ѝĕ<`P@|.0 @! @p `<>|0@@@ p8 AmP`z夏`0 MQ1 0@@TP  PZ Ѝ@`Ѝ x!1 0@@T`  P @t O@@|.~9 @ Ġ `M =X~!0R1 0@@TG  P @I |.@ @9@= >|0@@ r@P @- |.@ @r9@ `  ,>/OA|0@ @~ Ġ  ~ ?|0@@ @P o0Am@ 0P``M P :7S Ѝ@`ЍZP>SżX1 0@ R`  P `d|.@ @67 V a `@ R`  P2WPEUW R_  PЍ@`ЍS!P @S PRP  P'W`|.@ @PB7r Ǘ0`@|.0 @=7 L@a `d?|0@@6 `|.Ǘ@ @O7`@ PI `H?|0@@= `?|0@@B `0| 0@@OP LAm@`pM\(\`VZ 0Z0@.0 J    7S07Ѝ@`Ѝ  Z 0 IC@.@-  @@@0 |.H@-  @@@G0  Bm`: ,MⰟY0 @`0DTJ 1T. T^$ @h ! $&QP 04pWD;PE"2ᑳc&S S000 0200Uء",Ѝ@`Ёء Ѝ0SS009100QH @PH~ԢI p@I *q " SU  #e}  T 0P 0 `  P ` P100 @P100 Q00O04D#2ᐳc&S S 00P@hQ 0p W 0@` 0 4@` Ѝ> 0@P ! $PP  O<4>D#2#c&S S `` 0SS` QQ`  Q @R S S 80` 00@S`````P@PV`3 `#P@-0M  A 0 0Ѝ@Ѝ0P /P?5PAm@`j 00MT000M70 @  @]0Ѝ@` Ѝ\ @m MRJ @0J PZ " 7S07 Ѝ@Ѝ  @-@M0 CPЍ@ЍAmP `@`4M P :7S 4Ѝ@`ЁЍVW V V5 |.  @@@21S S. d`0c `@p /012. 1 0@@T`  PB2ʅHJP @SP0(C4?00Q1S $S0c! p"/000@Sh``@.0h``@0.0""#0 p"/01 .0X``@0.0`@qp0 0@/  |.2@ @` H`Xp0 0@/AP|@ R'PX``@~ @mMN|\S0%\ Oh@DQ l4\ S 0 Ѝ@Ѝ08@0P @CT C@PC3@ CD0 0@ P q0S7 0@S 0 S 0SSw?9w?@ P9w?9w?Am` M@P P 1 0@PU P@Ѝ@` ЍP``@7|.@ @j0 ` j``@(0 0@j|`@@-pMP@JP #80<@@L+\<@@ڶ3@<,03Ѝ@Ѝ@.8  @@@*2C,@Dl D B@0C@8BmP` WM$  @P! q p@`V7 kP0S 0 S! :0N7S< U`PD X58@ 0C BX5+Q 4,PB{3P@P ,0P3 0SP P0p CR0 Cp ` .Pv Wߍ@`Ёء Ѝ\P $\ UH00H0`P0Sv P hP0 0S0S S0S+ SO<h>D2ᑃcBSS00 R0S SV 0S < 0LEA0Ss`O<>D, @1cc000S < 0 " @1P 055 :U00000N'R\P \H H jP X% BX%0 [X 1S 0 @?XPh, 0< S  8NU0u0<0P @ 08<NUʶ#4<0 Q3 @0P 4P Pp0P  CW0 C&`P GPc  0S`O00ĞD00ā@&0멑0ii 0S)U>P0:00N'R\P %\H H P XŔ0 @LXń?? vPUhy?P x NxCP #P80<AwQڶ3x <x0R3x h6P0p  C0X C0`0p P `@L|.@ @=@ g``$ 0@|.0 @6B WK`@$L|.@ @7@ HyQ !Q=P^ Y:Pdk 0l4Q1 < - B Rr0!  00 4w`$hPS`|.@ @6@  eO<h>D2ᑃc40C?o2S 04V R 04S 4S040S_1 0@PU IP $P 0@0@|. @(6  `$ 1 0@|@t`@$ L1 0@|@@f#D0,<@0L, @D BLQ@  P `0$0 0 @|.0 @7 V 0 R2 Q <00CS1>N>P|.  @@@U>O<h>D2ᑃc4SS00_`0$01|0@@ s=0Si0S ,0SpRF <A?0Pl 0 4`$hPl`1 0@|@ l4SA 4.S>$04R9`P5 #80<A Q3 -< P hP`@.  @@@0 $,@ 0 @|0@@ x [P :PK`@L1 |0@@@Y|.  @@@6xl D B@D0C %=80 AQ]ڶ3 <03Z=P 0I>`@<L|.@ @86 @ t|.  @@@%5}<0`@<L1 0@8|@@t|.8  @@@5eD0l PD A0L@Z '0-#<Dl 0CD B@GD Ll @D0C@<:L7S/@Am@`` MPP#0: Pp P0uPU: 0S @P @9JPЍ@` Ѝ:DP@>0/0 00:P>7/ L7S /0S0M'RBm% P@` `|0M4S '&S 'S %S 1 0@ RW Pt7 0@eLk Ѝ@`Ёء Ѝ!S $S] S Y 0q p@D0<0 4  $ 0C,(00 2 R$ PG> 0@j*!$ H PJ 0P :N7S,O<4 >D#2c&S SQ@T P $~L0@|.0 @7>P D0q p@$00 ,0Y P 奙c02F )@*,8ΒI#:c<H S8>SD<>Q@0@>DU 3+S@0, #0<0  0@(0k+ , 0 P! $ aH0P00&0S 8  3I0P(0j (089S 0S1 00PI8 $3089,00@S (D)2R00%140 0S H9S Lc ʠ"F)@I"*bR H)*P9S Tɛc "F)@ Iɂ"*ᑒbR P) P&P @)\0@  H)Rz P)R 00@00P T  0 0 S$ #8<@P8ڶ@ <P P   L'R4 R00(0 厍P00 @ Q  'PU2 PWrpW W6 \P1 0@& Z Pတ0S0  *tD0p$0 yP q p@ R dP/c0) @2F )@ƒ#:#a0:`@ `F2V)3@ 0Cs0 S3@  \j< P Y0S  S S |.  @@@R90S H0D@ 0S 0 0S0 jj< P P P< 0Ps0P y디000:$ZpW PL0S\pW 07q p@Z P00Si Sx+  @P  O<4 >D#2c&S SpW P e0@|.0 @9 C 2  `C3 pP`X XD0崚{ `P  P @|. @3*X-  @<PC p P0: W 0Sj Sd#80< AQڶ3 < 03y0 $ ]fPM<0@  !0 !0>0 YXO 00P $ v00@|. @7 f@T P\ $ @ [20@|. @7 L1D΂0@>=lpP1 0@, Y PՏ0S.0 + 0 S ϗ(1P 1 0@pW xPp ' |.@ @2 `0: ="0R=0=-  @bPi =0=Py0 S R <P(1V pW 1P0 : eCx*0P00 *N'R O,4.D1""b R&Rg 0UP X%(0 B[X% (0P^ #80<<AL\ 3< < 0 B34 N=0: L7S P@ PEU3@ 0CP3@P,pu0@|.0 @9U k[$N,0@|.0 @84 <80@|.0 @': -{$^ 8 *008 @07(|.  @`$EP0@|.0 @9 4 RS!(0?0Q:q paAA ,   @`pA$P,0@|.0 @4" #80<@Pڶ3 < $ 03 { O<4>D!!a&Q Q: : \`Vp P^ ^|.@ @9$ ( ( 3,0@ |8@.`6| 0@@#1 0@@TR P $@m(60@|. @9 ^81|0@@'$<  8Q(58|0@< @0 1 0@pW P3 Ep22`0@|. @3 #|`( $RP6( |0@@-$Cp,4 0@p|@ PP0~\0y@.  @@@0#80< AQڶ3 $< 03CPJ 0 0 00!0!0V5E:?JH'㰐0P  @: : .ᜮl\^ `p$|.@ @8p : 6 0  R0 MP PPTX0\0`de f0`w 0@|.0 @? e-`@e 40@|.0 @I3 S+:@)EiE p  R"@ Q%R #E)%:V R P `0@|.0 @7'(0S0S }PD 2 ` Xt jPapW `P g`0@|.0 @?B F`$6 |0@@N0S S@T 3 @ N7S-  %0 s@S 0 @1@044 W 0@|.0 @9 ` 3 0@|@=\ `@ 43 0@I@|@/^$(0`04008|.@  @0400k4r@T P $(`@g0 0@|. @g4W`3|p0@@f2|0@@(00-00@ (00001 pRW 0SW 0 : BpW P 30@|.0 @9  2  `C3  p7| 0@@!#80< AQڶ3 < 0380E)R( @007P0@9 3000F9  S  R 00*P000F9X9S< #  X)2 S @ P P   d 70P  @$(0` 4 4 84k0@| @0 <7S+0 S 0@S (00S=(0000%1S6#80<@P.ڶ#<0@<  #!P0 P!0t6 0@|@ <70@`|. @ 2IlDl D B0C@N VE)0S P `|.@ @`7%$R`(6 `|0@@k 'q p@`V dPCc ,"Fʠ)@9:0C"j6fPVpW LP. ,V/   c@)@J3p BF)*`B Q Q0 Q00 BV Q2**j2ᗣcCCZ[-0CS000 : "=S h ,c2cSm-L@V 0$PP0@`V\ 0SH0S}p 0ss{⇟ YV R RM(@Y@ 0A0R D,0"@,0@Z (d`f|.`@ @'3 Wg`T2 `|0@@ 0 0ShH e   eD0D B0Ll @?$_ 0 +0 20@| @ p 0p%3w0 P3P:pPW3 O1D0@p$0 0ូl$ 30 P3PP 0<7| `0@@0S$``(0|.@ @ 7`S R  P0F9 PEP\0(wP        Z$00`^8 <|.(0@ @L0? 0 P0 X) PP\0@ 00@X 00$` q2 `|0@@ #80<@Pڶ#(0< =#5 50    !0!0(P  P    ',9``$]6( |0@`@[9 xP $00`G|.@ @~3 #80<@Pڶ3P <03 AB&>S Q@8P@0  CRuڶ#C @ #C3@ $00` ^p <4| 0@@Lq)|.8  @@@"= |.@ @?$`0 `|0@g@L`5|0@@Cql D BDQ`5| 0@@3a7| 0@@$j 2| 0@@k 1 0@|@ ypr`<2,Θ0@|.p @0? N. ,c$xL5| 0@@$P8L7| 0@@^Pᆃ,( l@`|.0 @{4P(0|{@`l40@F00@H 00L0S^ _P $0|.@ @>4  `<2,Θ 0@|@$00`3 0@~|@~<0@@ 0 0~0D(0|.@ @`0004(0|@`40@V|.  @@@3$3| 0@>@Ca`2 `|0@'@3|.  @@@3a`2 `|0@@#D0, <0L@D BLu|.d  @@@8mBm@ @P` $M5Udu\05H0=  P  `P@0@|.0 @0" .8@0 C0+R0ڶ#,CĠ @, # S,($ @CpCCaCC C$Ѝ@`Ёء $Ѝ2` @ k 70@| @ #D0, 0@h @0  P04D  x`@@p 0A T@@!P |.  @@@:*%.R 0< `8 0@|@o`@8 0@|@@{ ruAm`p`MP1@ 0@UpW\ "P8Ѝ@`ЍPU! P8Z4P \044< P 0<9 +.0 Ѝ@`Ѝ/` 9 0@|@2`@|.@ @: @ z`Pz 0@|.0 @:" j`@j8 0@|@@Am@``M1p 0@PU P `PK<0@|.0 @;" ;0 Ѝ@`Ѝ`p2<9 0@|p@AmP``MF1@ 0@pW5 rP 00CS 0 Ѝ@`Ѝz< P 0:%>S<9 < `pd0@|.0 @!; `d9 0@!|@}Am@``LM0PS ~pP1 0@`Vb P+ `@|.@ @:;@ 1 0@pW3 PPV$0 A ,0P   !LЍ@`ЁЍ9V`0@yp@p0@|.0 @?; pp`9V0@ጉ@j9 |0@?@`@\9 0@:|@@*-0/0C#N^-S< AoS0 s0浉s 0c0s0瑩0AmPP ` |@j@@ p@`@@ pU0 @ @0S S L@p00P X@h00@`Ѝ@Am|S`p`l @@ PWMp @a0S1 0@@T 3PL0[ 0/020 EBЍ@`ЁЍ 00X 2R0.Rht! \T:0S7 0 00a@0Do20 0W1 0@@d Tw PL0@00P 8a0@d*0 @t0 t0001 0@@TA P 8d*@ @l0 X8a: 0@td @xd*  @@@0U8u0@d*0 @0 p3T/ PP_8Z:d  0@l@J8O;d  0@p@8C<0@d*0 @0 p82<;d @ p0@P)RBm@`]p $M XWlj|0@/ (p0`= L @0@A z8\`P0`Pg6TX f6Fr0{B!n`=AgrpP AL0@ @qI   `P$(p,IBmJX` \MU ` @p R  Pq$8S0C$8\Ѝ@`Ёء Ѝj$0R 0 R"$80@  0R? p0H0R @ p0D0Ro*(``JV) V ` V R  P3 (X- ` @P)8@VL0PpH80P0@- @8L0> @`p $,D( 04(hj4tl @@ @S9` 0@?  0@@` Ѝ> 0@@` Ѝ^BmNR`p @@`  DM @P@`@N! @(10!t @@(K 0 0 0@80 0 040 } ]5]qK@1 < 0 00M 0 ( [p tPйDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDйDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDxXDDиDDDDDDDDpL1 0@p 0@t01 0@n 1 0@bX8! 0@ @L@ \ !L> @ 0@ @@ O@B01  0@ @0 @0 9@0: !01 @ 0@22 !X8 @ 0@ +Z01 0@K!L> 0@ 804 01C11040 0L. @@0 0S S S 1(@  0@@v001P40  0@ PPPTq< p@Ln0@  `@10SBR>P 0@  0@ @0`@T᠊@$@T! TPUY( [P h P0  @0 0 0*@ @P 0@T8Pp WЍ@`Ёء Ѝh P0  @0 :0 0@@ k@-hNP0 @@* @ 0MЍ@Ѝ0A@-MS6Pp\: @0 Ѝ@Ѝ\7 @0 Ѝ@Ѝ\@ @0 Ѝ@Ѝ\= @0 Ѝ@Ѝ1@ 0@ R P\+  @@@D0op;0@\+ @C0Sp;\ @0@@C@-MQ7@p\ @0 vЍ@Ѝ\ @0 jЍ@Ѝ\ @0 ^Ѝ@Ѝ\ @0 RЍ@Ѝ1@ 0@ R bP\+  @@@0 p;0@\+ @0p;\ @0@@@-MQ7000pp\ @0 Ѝ@Ѝ\ @0 Ѝ@Ѝ\ @0 Ѝ@Ѝ\ @0 Ѝ@Ѝ1@ 0@ R P\+  @@@0p;\ @0@@7p;0@\+ @0@-MQ+  `0\ @0 Ѝ@Ѝ\# @0 Ѝ@Ѝ\& @0 Ѝ@Ѝ1@ 0@ R P\+  @@@*0O;\ @0@@);0@\+ @)0+Q@-M0 Q@ Q 1 0@ R> wP.\+  @@@W0 \S @0   GЍ@Ѝ\M @0  :Ѝ@Ѝ\P @0  -Ѝ@Ѝp;0@\+ @V0p;\ @0@@V~Q@-M \` @0  Ѝ@Ѝ1@ 0@ R P p;0@\+ @c0\+  @@@d0p;\ @0@@cGQ@-M \m @0   Ѝ@Ѝ1@ 0@ R P p;0@\+ @p0v\+  @@@q0p;\ @0@@pQ@-M \z @0   Ѝ@Ѝ1@ 0@ R P p;0@\+ @}0?\+  @@@~0Ip;\ @0@@}Q@-M \ @0   cЍ@Ѝ1@ 0@ R sP p;0@\+ @0\+  @@@0p;\ @0@@@-@QM T \ @0 +Ѝ@Ѝ1 0@ R <P p;0@\+ @0\+  @@@0p;\ @0@@k0A@-SM \ @0  Ѝ@Ѝ1@ 0@ R P p;0@\+ @0\+  @@@0p;\ @0@@3@-@QM T \ @0 Ѝ@Ѝ1 0@ R P p;0@\+ @0b\+  @@@0lp;\ @0@@0A@-SM \ @0  Ѝ@Ѝ1@ 0@ R P p;0@\+ @0*\+  @@@04p;\ @0@@Q@-M \ @0  NЍ@Ѝ1@ 0@ R ^P p;0@\+ @1\+  @@@1p;\ @0@@Q@-M \ !@0  Ѝ@Ѝ1@ 0@ R 'P p;0@\+ @1\+  @@@1p;\ @0@@VQ@-M \F/@0  Ѝ@Ѝ1@ 0@ R P p;0@\+ @1\+  @@@G?p;\ @0@@Q@-M \%!@0  Ѝ@Ѝ1@ 0@ R P p;0@\+ @J?N\+  @@@)1Xp;\ @0@@J@-MQp0@pp00\6!@0 jЍ@Ѝ\9!@0 ^Ѝ@Ѝ1@ 0@ R nP\+  @@@=1p;0@\+ @O?p;\ @0@@O0t- @ 00S  P /0/Am@t]``pP@' @0B0S P 2V 01qg" @P@`ЍAmZ7`$MS0C7$Ѝ@`Ѝ0R@@DD074BcS@T@@1t@ 0@` @pt@Q= R#  P X-d0`p @0@P\@T@@ b0 @ @`^GX=Q`0@P @!\0@0@d@ 1 @@b`R  P l0`@ 0 @ Y0P`/s0@Dt@T@`l00@@BYy/0 *-0 $ %*-0 $ %*Am1 P``00@pM M(@T `3`@0 A@TЍ@`ЍQAm@`` M QP @0  Ѝ@` Ѝ   @@@0 0R*Ѝ@` ЍA@-0MQ/lHr%Ѝ@Ѝ+ @% +v @0 Ѝ@Ѝ Ѝ@Ѝ$Ѝ@Ѝ/   @@@}0QAm`` MP@/K @0 Ѝ@` ЍP   @@@O0\/0 )-0  !):AmM`-|pMT LaP`@240 }3\0 v@TЍ@`ЍAAm@`` MQ>h0r0!1Ѝ@` Ѝ*0P!1*L @0 /Ѝ@` Ѝ 1S  Ѝ@` ЍZ0 "?op2 1Ѝ@` Ѝ /L!  @@@0Am@P0` 0PP0Q \@!Q :`?S G0`   !@Ѝ7)QAm`pM..:-lM`V@V 00S :1PPP@VLd @0 Ѝ@`Ѝ+L!  @@@h0nQAm@`` M QPL @0 Ѝ@` ЍL!  @@@0K 0(Ѝ@` ЍQAm` M) Q!L@Z p @\3`sK0 `OkT0 I Ѝ@`ЁЍ!  @@@1 !LjQ0 @lP@3p(sK0 pO@TAm0` a M`@p!LZ @\o(sK0 pO%T Ѝ@`ЍAmP`@0  M$%R(T Ѝ@`Ѝ!LaZ @\`@qpsK0 pOTAmPA`@p$M4` Q@0%0)0S <U :0P`p`@oob1 0@0S 0,P( 0,p%: @0@!  @@^ X@V!0 @00;$Ѝ@`ЁЍ0 }?op2$0$Ѝ@`ЁЍf-0SY1 0@`V 0,wP 0,`Up1 0@! @04 $Ѝ@`ЁЍyr0%0$Ѝ@`ЁЍ(!Lza @|`@3P'sK0 PO7T%0S:1 0@0So `d!  @@@0,00U%Y`P1 0@pWo 0,P 0,p=1 0@! @ 0` @0 V,   @@@0: !W0@ @ppV@  @%*  @@ 2 0@@^ )@z p@@p1 p0@@E1 A0@@@-@P d@000$ %@Ѝ&AmP` M QAllllllpa`@\,M 0`!LZ  @\3p> sK0pONT Ѝ@`Ѝ!Lza @|`@3P&sK0 PO6T!  @@@`0 Q- M  1  @0 P Ѝ!  @@@00 M&0 =E&0 ==&AAm@P`` MQ`D0H RT  @0 Ѝ@` Ѝ0 ?op2<0Ѝ@` Ѝ+<0S 0 Ѝ@` Ѝ0=0P' @0 r0=0Ѝ@` Ѝ?'Ѝ@` Ѝl%"  @@@0? * 0SAAm@P``MQ񟗅 P<d0H R * 0S @0 8Ѝ@`Ѝ0 8?op2<0Ѝ@`Ѝ"+1 0@`VN 0,6P 0,`p_2 0@" @u0<0S 0 Ѝ@`Ѝ30=0& @0 r0=0Ѝ@`Ѝ&Ѝ@`Ѝ$"  @@@0p2 p0@u@'@-@!P !0P h@0000< =@Ѝ$Q@mP M Q Ѝ@ Ѝ$"  @@@V0]@*0H R S @0 } Ѝ@Ѝ * Q @0 l 0SQ Q- M  @0  X Ѝ"  @@@0 0$Q- M Q Q "  @@@0 @0  . Ѝ00HQ @0  Ѝ 0S/0 h$0 %a$-0 $ %V$-0 $ %K$Am@A`` M=D 0CQ=|Tr0%0Ѝ@` Ѝ%0P%0% @0 Ѝ@` Ѝ$ R  Ѝ@` Ѝ ?op2$0Ѝ@` Ѝ)#  @@@0oAm@PA`` M D @Q;Dr0%0Ѝ@` ЍE%0%0>%u @0 wЍ@` Ѝ$0S  Ѝ@` Ѝ0 l?op2$0Ѝ@` ЍV)#  @@@|0Q Q- M  @0  ? Ѝ#  @@@0 0#Q@m@ MPJD7)t;LQ M @0  Ѝ@Ѝ#K @0 #  @@@P0/0 X#0 %Q#-0 $ %F#-0 $ %;#AmPD`p@@ M6`A3  0 0T `0 ` Ѝ@`ЍAmP@``p MADQ;P(w0%0 Ѝ@`Ѝc$0%0\$ @0  Ѝ@`Ѝ$0S  Ѝ@`Ѝ0 ?op2$0 Ѝ@`Ѝt($  @@@0&00Sg :1P:p@`orV00SY1 0@0S 0,@P1 0,i1V 0@@WPa`@ j `@8: $9p0@ @D P@@@^W$0 @`$Ѝ@`ЁЍ80S2  $Ѝ@`ЁЍ090!00S80S 90S11 0@0Se 0,P 0,  P@r090$Ѝ@`ЁЍk!$Ѝ@`ЁЍ$  @@@0j @0 pV!: !X0@ @@8P* 9@ @@4p@@U0@ T@ v 㸁@@`p @@-@,P @z0,008 9@ЍQ Q- M  @0  2 Ѝ$  @@@0 0| Q- M  1  @0 P Ѝ$  @@@0@-@M Q! ` ` ` ` ` ` H 8 8 8 8 8 %B @0 Ѝ@ЍЍ@Ѝ$  @@@S0Bm]`z4PM` M8T @T  PT,t% @@PP 0[Z000$Y 0 !11 0@`V1 P=-@(= M-00=Ѝ@`Ёء Ѝ0  0 0@%0 @E0+p5 0@E@ Am`m4`MMV. p@T) P 6PT 1 0@0S1 ZP,< @ 0@@ Z=-00 B=-Ѝ@`ЁЍ %@ @X050@ X@j1Am@ 0@ `MRC P']4P=U  |Pf@@ p@`@ p0U@ = 00=Ѝ@`ЁЍ]=4P U 0 U$0@0i0% @r]=4PU 0 U$6 0@@i -=4 RS @-@̠ @@@Ѝ͑=0/BmP@(`p`P5 @;@$TYW qhP& @~!@wWpm@`Ё Ѝt%d  @@@0 %l  @@@0AmJ =4`MPSP ,P @ -=0 0 p`  0+=.0C R`#$ ->0S>0>U   1R c Ѝ@`ЍAm@P`` M0+(p130i P @0 5Ѝ@`Ѝ0 0  QR00 0S00/0> 0@J8Am@`MP 00/0S 0CP 00#Ѝ@`ЍuPP`0 R! @ R  P , *`@ @l0 P `F``C ,90@@l`AmQ`p M`3:-\MPT ꜐(1T @T PP @T *  @0   Ѝ@`ЁЍ䞨 *  @@@0@-0  0S S S @Ѝ2@ЍR@Ѝ.q@Ѝ1@-@ 0@ MR  P <0@ *0 @ 1. @ :0@  Ѝ@Ѝ <: 0@@ RAmP`M610` 0@ R]  P{N @@,p0(!-PpP Gp(!0p :0@ ʌ0&`BV@@BY.$0@ @ R&  PI> 0@'<pP" 0 g<Ѝ@`Ѝ\: 0@@t: `0@@@T(  TP  *p@ @1A \0@ *0 @ 1wt0@ *0 @ B1: `@0@ p@-@MT  +!@0  Ѝ@Ѝ *  @@@.1P /!AmP @0`MS% @ PЍ@`Ѝ @\ 0`@S pp0@ *0 @1@ v @C 0p@S ``: p 0@`@@ Am0.<Α0` M\ ^ >QS00Ѝ@` Ѝ0S0 0 *  @@@0D1@ 0@PU 0,P 0,Pd`: 0@ * @J0R`: ` 0@@Am@``MP)pP, 1 0@PU 0,KP 0,P)`t(; 0@ * @J0 * @0  Ѝ@`ЍgP1 0@, R\  PJ0 p@@,00 Z0R 080 PPW  @MP  PUX 0,P 0,P`x *p@ @0B y  @0   *@ @0p c; 0@@`(; ` 0@@p@rPP 0@ 0|kz`x; ` 0@@Q0S/:.>Q 0 QR *@-  @@@100/0Q@-M S0@ * @0  4Ѝ@Ѝ *  @@@0  @  Ѝ@Ѝ@m@ M PU P Ѝ@ Ѝ1 0@ R  "P Ѝ@Ѝ(  *P@ @e1 (< 0@@eR@-0S Q 00@Ѝ`@Ѝ *L  @@@r10@-(M( "tP1S0(Ѝ@Ѝ1 0@@T P @hX *@ @v?_ *  @@@1gQX< @0@ v>@-@ 0@!> 0@, @@Ѝ*.0@@fH0P  @ 8>0@Ѝ@` ЍR!  IP 0@.0 @ ^0 =0@ =0@=0@@^n: Am/8` @MR 0Q 0S 0S 1 0@ RK P 0@.0 @0Ѝ@` ЍP@PEUP1 0@`V3 P,<  @ 0@P  @0 0@Ѝ@` Ѝ\.@ @0 ^>@0@@\> 0@@Am#P@0@ ` M \PЍ@` Ѝ 1 0@`V P Q0@. @0w0 @ >0@w @Bm@0 `@ M"0P 0 h0#@(AP 080< @Q  3< 03 J0P0u $ :-,00 S !~ $O pG` P(`sV㇟0Yh @(R1 0@ Ry P 0$(@. @00)1  P 0pO`PP @u0Z0S P 0ShP0# y > P#0@W%P*0`p !Ѝ@`Ёء Ѝ1 0@ RG P$ 1 0@ R2 P 0@.0 @0.0(@$?0@)K 0.@ @00 l @D@0CD L ?0@@>0@@@-@; P #<0 B 0C0#<0@Ѝ,0 @ :Am@` NgMV!0SK P<A Q 1 0@ R7 (P `0^8  0@ @D@Ѝ@Ѝt?@0@@\AmJ``@ Poh= o80-`/??@ Ѝ:/r ?S /AmZ?`MS@Ѝ@`Ѝ̏>p`0@ ?0o@p p@P1 0@ )R TP ϕp@@. @b1\P ϕ?@0@@\bPzR *P ϕ@@.W?p @\Pϕ?P@0@@W\PS Bm @@ 0P``ᣑM 0pQ# w0S~ ^Xc ~0p s QsXYz sp#r0 sp3s0! @q 0wp00R 0^ P20 :PNPr gPH P@ P@/ 0- 3?80$Mp40LXЍ@`ЁЍ0@.0 @T0%~0Y*1 0@ R wP 0@.0 @L0 00p0@@T 0{?0@@L00AmL 0`Rp, @PLPP T@P0P0UnPPMXU[TP N3T TPXP L0X00`L0@Ѝ.8  @@@1T/Bm P @PU P .@ @0v 000PT} /N<Pލ@`ЁЍ.`  @@@1l.  @@@>dr=| 0/X! @i@PO p000P >  ~ @   q @ ?Y@(OM uP E0@.0 @0 50 0@@@c0 @T0 R- JP~ ` 0@.0 @z?p R. 3PT 0T0a0 0@@j` 1@0@zaLN40`@.0 @1PN41`0@@PHAm@` M`00FXPP  0T#P T(TN PЍ@` Ѝ>- M0 FXP 1 ЍR !\ A\ \ /RF R00SF /PF R R  R/R00 1AmP 0@@`p`MT9 P `Pl@@!@ @0" Ѝ@`Ѝ@o/00S!R "R00S00S/@o/`PWl1 0@@PAm` M ` tPP0@rS sS0S0S pW  P1 0S$0xS Ѝ@`Ѝ0S0SpW  P 1P 00.  @s#!<$00!D#Am@ @` PP PP@` ЍP 06/Am@5 ``P  K/(* Jx P 6&0s0RS0P6@` ЍAm@5 ``6P ( J 6&0s0TS0P6@` Ѝ*@-6S rQ S @ЍRQ S RQ S R#R5 (   $Bm@ʌ_`MU6 \3 ^0Q0`0S} pb 0 0:?SEY* )0P0\p@@@ Ѝ@`ЁЍS}p0 S/0xSYO<>D! @㓡1c0S< 0 000:?S* 0 $UP(0S,0S0S "1RQ 0 H00Y 0 0Q  H!  @@@0S!  @@@0K-P$M00  B =$ЍBm` iMP ` B@@㹰 [a Pp5 `0 ^Y:`0P[L 00M00N0 PP빰Am 0@P@` <<`M0@0@ Ѝ>@@- 0@@0@="PD<0@0@Ѝ 0h@-@@ @Ѝ@-@ @0.u <<0@0@ЍAm P@ ` Mz`H  @0` 0J 0h@ RЍ@` ЍAm@ @@`` PP0>@ 0@`` ЍSRQPM`-Ѝ /@-MSBm`p $/RPooV pfV0wƠv%u,84tg8R 0RUP@D@D0 C|00 bȃ QL@^ 0<Ơ0S ^ @@`Ёء ЍOoT Pd2%140Š#xČs9,h$ᗹk  hQ `QSPII``F|0`f Ȍ Z 3# ZQ@@  Lh\:R#2Q^@ R 1$ %04llx), LEDs: ACT %d Model specific options: -w --hw-version Print the targeted HW Version -M --pcu-direct Force PCU to access message queue for PDCH dchannel directlywMsysmobts was compiled for hw version 2.Abis closehw-versionpcu-direct"(6!*1l2hmsgb_l2len(msg) <= sizeof(l1p->u.phDataReq.msgUnitParam.u8Buffer)%s %s PH-DATA.req(%s) %s %s MQ_L1_WRITE queue full. Dropping msg. fl1h->phy_inst%s Rx PH-RTS.ind SAPI=%s %s MQ_L1_WRITE queue full. Dropping msg. %s PH-DATA-INDICATION for unknown sapi %s (%d) %s Rx PH-DATA.ind %s (hL2 %08x): %s, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s Rx PH-RA.ind, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s PH-RACH-INDICATION has %d bits msgb(%p): No room for primitive msgb(%p): No room for primitive data sys_primunknown MPH-INFO.req %d unknown prim %d op %d Rx L1 prim %s on queue %d l1_if.c:82Rx SYS prim %s Tx RF-MUTE.req (%d, %d, %d, %d, %d, %d, %d, %d) Ignoring Clock Calibration for selected %s clock Using external attenuator. %u.%u dsp %u.%u.%u fpga %u.%u.%uBTS band %s not supported by hw Operating without calibration; unable to load tables! Tx SET-TRACE-FLAGS.req (0x%08x) MQ_SYS_WRITE queue full. Dropping msg Rx L1-RESET.conf (status=%s) L1-RESET.conf with status %s L1-RESET failuresysmoBTSv2 L1IF compiled against API headers v%u.%u.%u struct femtol1_hdlFailed to read from EEPROM. Read clock calibration(%d) from EEPROM. Unable to read band support from EEPROM, assuming all bands Clock source defaulting to GPS 1PPS on sysmoBTS 2050 l1_if.c:1742l1_if.c:1749RfClockInfo iClkCor=%d/clkSrc=%s Err=%d/ErrRes=%d/clkSrc=%s Calibrating GPS against GPS doesn not make sense. No reference clock set. Please reset first. Couldn't determine the clock difference. Cannot open L1 interface Unknown/Unsupported sysmoBTS Model Number %u Assuming 1002 for sysmoBTS Model number %u Cannot determine nominal transmit power. Assuming 23dBm. lchan2lch_parvwvLwvv         oml.c:1115%s : %s tch_mode=0x%02x oml.c%s Channel mode %s is not supported! %s MPH-CONFIG.conf (%s) setTxPower %f dBm Rx RF-MUTE.conf status=%s RF-MUTE failureACTIVE ACT_PENDING DEACT_PENDING cnf->u8Tn < TRX_NR_TS%s %s Rx mphConnectCnf flags=%s%s%s DSP L1 is no longer sending primitives! %s Rx mphDisconnectCnf BSIC=0x%08xBS_AG_BLKS_RES=%u MS Power Level 0x%02xamrCmiPhase=0x%02x amrInitCodec=0x%02x (%x %s Requested TS connect as %s, expected a specific pchan instead %s pchan=%s ts_connect_as(%s) logChComb=%s Close TRX %u %s cannot determine L1 SAPI oml.c:1064%s MPH-ACTIVATE.req (hL2=0x%08x, %s %s SET_CIPHERING (ALG=%u %s) oml.c:1356%s MPH-CONFIG.req (%s) cfgParams Tn=%u, subCh=%u, dir=0x%x oml.c:738oml.c:746%s all SAPIs already released? %s MPH-DEACTIVATE.req (%s Unimplemented command type %d oml.c:757struct sapi_cmd%s act failed mark broken due status: %d Queue is now empty. More pending.oml.c:785%s End of SAPI cmd queue encountered.%s Failed to find lchan for hLayer3=0x%x %s MPH-ACTIVATE.conf (%s Successful activation of L1 SAPI %s on TS %u Error activating L1 SAPI %s on TS %u: %s %s Got activation confirmation with empty queue %s Confirmation mismatch (%d, %d) (%d, %d) RX_REQ -> RX_CONF RX_CONF_TX_REQ -> RXTX_CONF RXTX_REQ -> RX_CONF_TX_REQ unhandled state %u %s Got ciphering conf with empty queue %s MPH-DEACTIVATE.conf (%s Successful deactivation of L1 SAPI %s on TS %u Error deactivating L1 SAPI %s on TS %u: %s %s Got de-activation confirmation with empty queue %s Trying to activate lchan, but commands in queue %s is now broken. Stopping the release. Rx %s, status: %s ====> trying to activate lchans of BCCH Rx MPH-INIT.conf (status=%s) Rx MPH-INIT.conf status=%s MPH-INIT failureUnsupported GSM band %s Init TRX (ARFCN %u, TSC %u, RxPower % 2f dBm, TxPower % 2.2f dBm Discarding adm change command: pending procedure on RC %d %s modifying channel for handover %s already in release request state. %s TS disconnect Set NB TSCSet Tx power levelSet logical channel paramsConfigure ciphering paramssysmobts_vty.c:143 %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-thresh lower %u upper %u'.%sactivatePHY Clock Source: %s%sCannot find PHY link %u%sCannot find PHY instance %u%sDSP Version: %u.%u.%u, FPGA Version: %u.%u.%u%sGSM Band Support: enableddisabledFemto L1 DSP trace flags:%sDSP Trace %-15s %s%s nominal-tx-power %d%s dsp-trace-flag %s%s clock-calibration eeprom%s clock-calibration %d%s trx-calibration-path %s%s clock-source %s%s|trx <0-0> dsp-trace-flag (Transceiver related commands TRX number DSP Trace Flag no trx <0-0> dsp-trace-flag (Negate a command or set its defaults Transceiver related commands TRX number DSP Trace Flag dsp-trace-flag (no dsp-trace-flag (Negate a command or set its defaults DSP Trace Flag no trx <0-0> <0-7> loopback <0-1>Negate a command or set its defaults Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> <0-7> loopback <0-1>Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> rf-clock-info correctTransceiver related commands TRX number RF Clock Information Apply trx <0-0> rf-clock-info resetTransceiver related commands TRX number RF Clock Information Reset the counter trx <0-0> tx-power <-110-100>Transceiver related commands TRX number Set transmit power (override BSC) Transmit power in dBm trx <0-0> <0-7> (activate|deactivate) <0-7>Transceiver related commands TRX number Timeslot number Activate Logical Channel Deactivate Logical Channel Logical Channel Number show phy <0-255> instance <0-255> system-informationShow running system information Transceiver related commands TRX number Display information about system HIDDENNegate a command or set its defaults Transceiver related commands TRX number Transceiver related commands TRX number show dsp-trace-flags trx <0-0>Show running system information Transceiver related commands TRX number Display the current setting of the DSP trace flagsshow phy <0-255> clock-sourceShow running system information Transceiver related commands TRX number Display the clock source for this TRXnominal-tx-power <0-100>Set the nominal transmit output power in dBm Nominal transmit output power level in dBm uplink-power-target <-110-0>Obsolete alias for bts uplink-power-target Target uplink Rx level in dBm trx-calibration-path PATHSet the path name to TRX calibration data Path name clock-source (tcxo|ocxo|ext|gps)Set the clock source value Use the TCXO Use the OCXO Use an external clock Use the GPS pps clock-calibration <-4095-4095>Set the clock calibration value Offset in PPB clock-calibration defaultSet the clock calibration value Default Clock DAC value clock-calibration eepromUse the eeprom clock calibration value       %s RTP IN: %s tch.cRTP HR frame length %u != expected %u Unhandled DTX DL AMR FSM state %d %s unable to parse RTP payload %s RTP->L1: %s %s %s chan_nr %d Rx Payload size 0 L1P-to-RTP%s %s DTX: received ONSET from L1 (%d bytes) %s %s DTX: received SID_FIRST_P1 from L1 (%d bytes) %s %s DTX: received SID_FIRST_P2 from L1 (%d bytes) %s %s DTX: received SID_FIRST_INH from L1 (%d bytes) %s %s DTX: received SID_UPDATE_INH from L1 (%d bytes) %s %s %s Rx Payload Type %s is unsupported L1 HR frame length %u != expected %u %s %s %s Rx Payload Type %s incompatible with lchan %s %s chan_nr %d Rx FACCH  /sys/class/leds/%s/brightnessactivity_ledonline_ledH\pԒ$|v+ @Error reading RxCalibration from EEPROM, band=%d, ul=%d, err=%d calib_file.cError reading TxCalibration from EEPROM, band=%d, err=%d Reading an int from calib data failed. %f Reading a float from calib data failed. %s/%sFailed to open '%s' for calibration data. %s: u8IqImbalMode=%d FIXUPNO FIXUPUnable to read Ethenet MAC from EEPROM No calibration table fix-up needed, firmware < 3.3 MAC Address is %02x:%02x:%02x:%02x:%02x:%02x -> %s fileeepromL1 calibration table %s loaded (src: %s) L1 calibration table loading complete! No band_support?!? calib_rxu_850.cfgcalib_rxu_900.cfgcalib_rxu_1800.cfgcalib_rxu_1900.cfgcalib_rxd_850.cfgcalib_rxd_900.cfgcalib_rxd_1800.cfgcalib_rxd_1900.cfgcalib_tx_850.cfgcalib_tx_900.cfgcalib_tx_1800.cfgcalib_tx_1900.cfgr+/sys/bus/i2c/devices/i2c-1/1-0050/eepromeeprom fopeneeprom fseekeeprom fread %.4x| %.2x ;123456789:<=>@ABCDEFGHIJKLMNOPQRSUVWXYZ[\]^_`X`l|  ̗/sys/devices/platform/i2c_davinci.1/i2c-1/1-0050/eepromComputed CRC(%d) wanted CRC(%d) sysmoBTS 1002sysmoBTS 1002+GPS+PoEsysmoBTS 2050 (master)sysmoBTS 2050 (slave)sysmoBTS 2050 (unknown)Unknownethaddrclk-factorytemp-dig-maxtemp-rf-maxserial-nrhours-runningboot-countkeymodel-nrmodel-flagstrx-nrError setting new correction value.successsysmobts_ctrl.c%d,%s,%d,%d,%sclock-correctionclock-infoprim_size_for_queueread_dispatch_one$@\șmsgb->l1herror writing to L1 msg_queue: %s l1_transp_hw.cshort write to L1 msg_queue: %u < %u writing on a wrong queue: %d false1l_fdfailed to read from fd: %s [%d] unable to open %s for reading: %s [%d] unable to open %s for writing: %s /dev/msgq/superfemto_arm2dsp/dev/msgq/gsml1_sig_arm2dsp/dev/msgq/gsml1_tch_arm2dsp/dev/msgq/gsml1_pdtch_arm2dsp/dev/msgq/superfemto_dsp2arm/dev/msgq/gsml1_sig_dsp2arm/dev/msgq/gsml1_tch_dsp2arm/dev/msgq/gsml1_pdtch_dsp2armee x  ( < H D|̜, X  ,shadow(bts=%u,trx=%u,ts=%u%s)PDCH(bts=%u,trx=%u,ts=%u%s,pchan=%s as %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s switching %s -> %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s)Physical Channel not configuredFCCH + SCH + BCCH + CCCH (Comb. IV)FCCH + SCH + BCCH + CCCH + 4 SDCCH + 2 SACCH (Comb. V)TCH/F + FACCH/F + SACCH (Comb. I)2 TCH/H + 2 FACCH/H + 2 SACCH (Comb. II)8 SDCCH + 4 SACCH (Comb. VII)Packet Data Channel for GPRS/EDGEDynamic TCH/F or GPRS PDCHUnknown / Unsupported channel combinationFCCH + SCH + BCCH + CCCH + CBCH + 3 SDCCH + 2 SACCH (Comb. V)7 SDCCH + 4 SACCH + CBCH (Comb. VII)Dynamic TCH/F or TCH/H or SDCCH/8 or GPRS PDCHNONECCCHCCCH+SDCCH4SDCCH8TCH/F_PDCHUNKNOWNCCCH+SDCCH4+CBCHSDCCH8+CBCHTCH/F_TCH/H_SDCCH8_PDCHBTS process timersabisAbis (RSL) related timerssysinfo.c%s: Unable to determine actual BS_AG_BLKS_RES value as SI3 is not available yet, fallback to 1 %s: Unable to determine actual NCH Position value as SI1 is not available yet. Disabling GPRS Indicator in SI (No PCU connected) Enabling GPRS Indicator in SI (PCU connected) Cannot parse SI4, hence not patching GPRS indicator $WOMLOC=%s INST=(%02x,%02x,%02x)msgb(%p): Not enough headroom msgb_push (allocated %u, head at %u < want headroom %u, len %u, tailroom %u) msgb->l3h%s: Sending FOM failed (no related BTS object found) %s: Tx %s %s: Sending %s to BSC: %s AVAIL STATE %s -> %s %s OPER STATE %s -> %s %s ADMIN STATE %s -> %s msgb(%p): msgb too small to pull %u (len %u) %s: Sending FOM NACK with cause %s %s: Sending FOM ACK %s: Failed to send ACK/NACK %s: Rx SET BTS ATTR New value for Attribute not supportedGiven ARFCN %u is not supported%s: Given ARFCN %u is not supported NM_ATT_START_TIME Attribute not supportedoml_bts_attroml.c:940oml.c:945%s: WARNING: Radio Link Timeout explicitly disabled, only use this for lab testing! %s: Given Conn. Failure Criterion not supported. Please use criterion 0x01 with RADIO_LINK_TIMEOUT value of 4..64 %s: Ignoring T200 BTS attribute. %s: T3105 must have a value != 0 %s: SET BTS ATTR: this BTS model does not support TSC %u != BSIC-BCC %u (TSC %u) %s: Rx SET RADIO CARRIER ATTR New value for Set Radio Attribute not supportedoml_trx_attroml.c:1138oml.c:1143%s: Set RF Max Power Reduction to %d dBm %s: Expecting only one ARFCN, because hopping not supported Given ARFCN %u is unsupported%s: Given ARFCN %u is unsupported OML-ack_nackUnknown/unhandled PCHAN type: %u %s %s: Rx SET CHAN ATTR New value for Set Channel Attribute not supported%s: SET CHAN ATTR: Frequency hopping not supported %s: SET CHAN ATTR: HSN and/or MAIO is missing: hsn=%u, maio=%u %s: SET CHAN ATTR: ARFCN list is missing %s: SET CHAN ATTR: ARFCN list is too long %s: SET CHAN ATTR: ARFCN list has odd length %s: SET CHAN ATTR: Starting time not supported oml_chan_attr%s: SET CHAN ATTR: invalid attribute value, rc=%d oml.c:1363oml.c:1369%s: SET CHAN ATTR: invalid Chan Comb 0x%x (pchan=%s, handle_chan_comb() returns %d) oml.c:1379%s: SET CHAN ATTR: this BTS model does not support TSC %u != BSIC-BCC %u oml.c:1397%s: SET CHAN ATTR (TSC=%d pchan=%s hsn=%u maio=%u chan_num=%uInitializing OML attribute definitions %s: Rx GET ATTR %s: Get Attributes for unknown Object Instance Get Attribute parsing failureGet Attribute without Attribute Listosmobtsmsgb(%p): msgb too small to get %u (len %u) %s: O&M Get Attributes [%u], %s is unsupported %s: Responding to O&M Get Attributes message with NACK 0%x %s: Rx CHG ADM STATE %s: Rx CHG ADM STATE: error during TLV parse %s: Rx CHG ADM STATE: no ADM state attribute %s: ADM state already was %s %s: ADM STATE %s -> %s %s: Rx IPA SET ATTR New value for IPAC Set Attribute not supported oml_ipa_attroml.c:1849Manufacturer O&M message too short Manufacturer OML message != ipaccess not supported msgb(%p): Negative length is not allowed Unexpected BTS %d in manufacturer O&M %s (exp. 0 or 0xFF)%s: TLV parse error %d %s: Rx IPACCESS(0x%02x): %s Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x for unknown TRX_NR=%u %s: Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x unknown Manufacturer O&M msg_type 0x%02xOML message too short Unsupported segmented O&M message Short OML message: %u < %u Formatted O&M message too short%s: GET ATTR with off-by-3 length: Fixing up for OS#3799 %s: OML message with %u extraneous bytes at end: %s Unexpected BTS %d in formatted O&M %s (exp. 0 or 0xFF)%s: Rx OPSTART %s: ... automatic ACK, OP state already was Enabled mo->fiunknown Formatted O&M msg_type 0x%02xunknown O&M msg_disc 0x%02x   27)L4m:Vs 0@PdIJز     صD$Hpȴܴ@Tt ,L\ض (8\hܷ0<XhԸ(@<LtUpdated AGCH max queue length to %d bts.cstruct gsm_btsbts%dgprs_cell%d-0bts.c:287bts->features != NULL/tmp/pcu_btsbts->smscb_basic.ctrsbts->smscb_extended.ctrsrc == 0Main link established, sending NM Status AGCH: too many messages in queue, refusing message type %s, length = %d/%d Unhandled RSL channel type=0x%02x/rate=0x%02x %s BCCH carrier power reduction is not supported by this BTS model %s BCCH carrier power reduction value (%u dB) is incorrect or out of range %s BCCH carrier power reduction: %u dB (%s) DSP/HW based MS Power Control LoopMeasurement and Payload data combinedOML RadioChannel MO depends on RadioCarrier MOUplink interference measurementsBTS_TYPE_VARIANTBTS_SUB_MODELTRX_PHY_VERSIONunknownosmo-bts-lc15osmo-bts-oc2gosmo-bts-octphyosmo-bts-sysmoosmo-bts-trxosmo-bts-virtualosmo-bts-omldummyTime to wait between Channel Activation and dispatching a cached early Immediate AssignmentTime after which osmo-bts exits if regular ramp down during shut down process does not finish (s)Time after which osmo-bts exits if requesting transceivers to stop during shut down process does not finish (s)cbchcell broadcast channelcbch:rcvd_queuedReceived + queued CBCH messages (Abis)cbch:rcvd_droppedReceived + dropped CBCH messages (Abis)cbch:sent_singleSent single CBCH messages (Um)cbch:sent_defaultSent default CBCH messages (Um)cbch:sent_nullSent NULL CBCH messages (Um)base transceiver stationpaging:rcvdReceived paging requests (Abis)paging:dropDropped paging requests (Abis)paging:drop-psDropped paging requests (PS/PCU)paging:sentSent paging requests (Um)paging:congPaging congestion detected (Abis)rach:rcvdReceived RACH requests (Um)rach:dropDropped RACH requests (Um)rach:handoverReceived RACH requests (Handover)rach:vgcsReceived RACH requests (VGCS)rach:csReceived RACH requests (CS/Abis)rach:psReceived RACH requests (PS/PCU)agch:rcvdReceived AGCH requests (Abis)agch:sentSent AGCH requests (Abis)agch:deleteSent AGCH DELETE IND (Abis)rtp:rx:totalTotal number of received RTP packetsrtp:rx:markerNumber of received RTP packets with marker bit setrtp:rx:drop:preenTotal number of received RTP packets dropped during preeningrtp:rx:drop:loopbackTotal number of received RTP packets dropped during loopbackrtp:rx:drop:overflowTotal number of received RTP packets dropped during DL queue overflowrtp:rx:drop:v110_decTotal number of received RTP packets dropped during V.110 decodertp:tx:totalTotal number of transmitted RTP packetsrtp:tx:markerNumber of transmitted RTP packets with marker bit set bts_sm.c:44struct gsm_bts_smbts_smgprs_nse0gprs_nsvc%d-%dstruct gsm_bts_trx_tsbts_trx.cts != NULLtrx->ts[tn].mo.fi != NULLbts_trx.c:137bts_trx.c:140struct gsm_bts_trxbts%d-trx%d%s-ts%u(trx=NULL)(bts=%d,trx=%d)%u/%u/%u%s RSL link up Failed to establish RSL link (%d) GHrsl_rx_paging_cmdrsl_rx_sms_bcast_cmdrsl_rx_notification_cmdrsl_rx_osmo_etws_cmdrsl_rx_bs_pwr_ctrlrsl_rx_encr_cmdrsl_rx_ms_pwr_ctrlrsl_rx_meas_preproc_dftrsl_rx_bcch_inforsl_rx_sacch_inf_modrsl_rx_ipac_dlcxrsl_rx_mode_modifrsl_rx_sacch_fillrsl_rx_ipac_XXcxrsl_rx_imm_assrsl_rx_chan_activ%s Channel Mode IE is not present rsl.c%s Training Sequence IE is not present %s Channel Mode IE contains unknown 'Channel rate and type' value 0x%02x %s Channel Mode IE contains an unknown/unhandled combination of 'Speech or data indicator' 0x%02x and 'Speech coding algorithm/data rate' 0x%02x %s Channel type=0x%02x/mode=%s is not supported by the PHY %s BTS doesn't support cipher %s %s Encryption Info cannot have len=%d %s Setting lchan cipher algorithm %s %sunknown chan_nr=0x%02x %s %smismatching chan_nr=0x%02x %s This PHY does not support lchan TSC %u != BSIC-TSC %u, sending NACK %s Missing MultiRate conf IE (TCH mode is %s) %s Unexpected MultiRate conf IE (TCH mode is %s) %s Error parsing MultiRate conf IE RSLACTDEACT%s Tx PDCH %s NACK (cause = 0x%02x) %s (ss=%d) %s Tx CHAN ACT ACK 0x%02x: Tx MODE MODIFY NACK (cause = 0x%02x) Sending Channel Activated NACK: cause = 0x%02x Tx RSL Error Report: cause = 0x%02x size >= headroomRSL Radio Link Layer message too short Rx RLL %s for unknown lchan %s Rx RLL %s for lchan which isn't active %s Rx RLL %s Abis -> LAPDm RSL rx RLL: %s %s(): rsl_tlv_parse() failed BTS paging table is full%s %s(): chan nr is not Downlink CCCH FACCH copyETWS Primary Notification OFF rsl.c:979ETWS Primary Notification: %s rsl.c:989rsl.c:991%s Fast Power Control is not supported %s Failed to parse BS Power Parameters IE %s BS POWER CONTROL: attenuation change %u -> %u dB %s Fwd RSL ENCR CMD (Alg %u) to LAPDm %s Rx MS POWER CONTROL %u %s Failed to parse MS Power Parameters IE %s Unable to calculate power levels to dBm: %u -> %d, %u -> %d %s Rx Measurement Pre-processing Defaults rsl.c:1346rsl.c:1351rsl.c:1364rsl.c:1369struct gsm_power_ctrl_params Rx RSL SI 0x%02x not supported. Truncating received Full BCCH Info (%u -> %zu) for SI%s Rx RSL BCCH INFO (SI%s, %u bytes) Rx RSL SI2quater count updated: %u -> %d Rx RSL SI2quater with index %u > count %u Rx RSL SI2quater with impossible parameters: index %u, count %ushould be <= %u BCCH INFO Rx RSL BCCH INFO (SI%s) RX RSL Disabling BCCH INFO (SI%s) %s Starting time not supported %s Rx SACCH SI 0x%02x not supported. Truncating received SI%s (%u -> %zu) to prepend LAPDM UI header (2 bytes) %s Rx RSL SACCH FILLING (SI%s) %s Rx RSL Disabling SACCH FILLING (SI%s) %s RSL Tx %s %s RSL Tx IPAC_DLCX_NACK %s RSL Tx IPAC_DLCX_ACK Closing RTP socket on DLCX %s Tx MODE MODIF ACK Rx SACCH SI 0x%02x not supported. Rx RSL SACCH FILLING (SI%s, %u bytes) Rx RSL Disabling SACCH FILLING (SI%s) CRCXMDCX0.0.0.0%s IPAC_%s: connect_ip=%s connect_port=%u speech_mode=%u payload_type=%u payload_type2=%u osmux_cid=%u rtp_extensions=%u %s Rx RSL IPAC %s, RTP_PT and RTP_PT2 in same msg !?! csd_fmt_d=%d csd_fmt_ir=%d %s Rx RSL IPAC %s, csd_fmt_d=%d is not supported %s Rx RSL IPAC XXcx without Osmux CIDgoes against configured Osmux policy 'only' %s Rx RSL IPAC MDCX, but we have no RTP socket! %s Rx RSL IPAC XXcx with Osmux CIDgoes against configured Osmux policy 'off' %s Rx RSL IPAC MDCX with Osmux CID, CRCX was configured as RTP! %s RSL Tx IPAC_%s_ACK (local %s:%u, remote %s:%u) Tx RSL RF RESource INDication Early IA check: %s (ss=%d) PDCH release: not in PDCH mode %s PCU rel ack for unexpected lchan kind %s %s not sending REL ACK %s (ss=%d) %s Tx CHAN REL ACK %s Sending HANDOver DETect %s Sending LISTENER DETect %s Sending TALKER DETect %s not sending CHAN ACT %s %s missing Activation Type %s error: lchan is not available, but in state: %s. %s error: reactivation on inactive lchan. %s rx chan activ but TS not in nm_state oper=ENABLED avail=OK, nack! chan nr 0x%x not covered by dyn_pchan_from_chan_nr() %s rx chan activ %s dyn_ts_l1_reconnect %s Cannot reconnect as pchan %s %s Disconnect lchan->pending_chan_activ == NULL%s Missing Handover Reference IE %s BS Power attenuation %u dB %s Error parsing SACCH INFO IE %s chan_nr=%s type=0x%02x=%s mode=%s %s Cannot send act ack: %d %s Activate via PCU %s Activate via PCU when PCU connects %s Sending Connection Failure: cause = 0x%02x Sending Channel Required %s Sending RTP delete indication: cause = %s %s Internal Error: both PDCH ACT and PDCH DEACT pending PDCH %s on dynamic TCH/F_PDCH returned error %d %s %s switched to %s mode (ts->flags == %x) %s Tx PDCH %s ACK Failed to transmit PDCH %s ACK, rc %d %s PDCH DEACT operation: channel disconnected, will reconnect as TCH %s PDCH ACT operation: channel disconnected, will reconnect as PDTCH %s Disconnected %s Dyn TS disconnected, but invalid desired pchan: %s %s Connect %s PDCH ACT IPA operation failed (%d) in bts model %s PDCH DEACT error: timeslot connected, so expecting lchan type TCH/F, but is %s %s PDCH DEACT operation: timeslot connected as TCH/F %s PDCH ACT error: timeslot connected, so expecting lchan type PDTCH, but is %s %s PDCH ACT operation: timeslot connected as PDTCH %s PDCH ACT OSMO operation failed (%d) in bts model %s Connected %s chan_num:%u Tx MEAS RES valid(%d), flags(%02x) %s Send Meas RES: NUM:%u, RXLEV_FULL:%u, RXLEV_SUB:%u, RXQUAL_FULL:%u, RXQUAL_SUB:%u, MS_PWR:%u, UL_TA:%u, L3_LEN:%u, TimingOff:%u []msg%s (%s) is not active. Dropping message (len=%u): %s %s RLL EST IND without contention resolution. %s Short GPRS SUSPEND REQ received, ignoring %s Fwd GPRS SUSPEND REQ for TLLI=0x%08x to PCU %s Fwd RLL msg %s from LAPDm to A-bis %s Scheduling %s to L3 in next associated TCH-RTS.ind %s Dropping pending release indication message ACT DEACTRSL message too short RSL Common Channel Management message too short RSL rx CCHAN: Rx RSL %s for unknown lchan %s Rx RSL %s %s unimplemented RSL cchan msg_type %s %s undefined RSL cchan msg_type 0x%02x RSL Dedicated Channel Management message too short %s ss=%d Rx RSL %s %s ss=%d state=%s Rx RSL RF Channel Release, but is already inactive; just ACKing the release %s Request to PDCH %s, but PDCH%s%s is still pending %s Request to PDCH %s, but lchan is still in state %s %s Attempt to PDCH %s on TS that is not a TCH/F_PDCH (is %s) %s Request to PDCH %s, but is already so %s unimplemented RSL dchan msg_type %s %s undefined RSL dchan msg_type 0x%02x undefined RSL TRX msg_type 0x%02x RSL ip.access message too short %s unsupported RSL ip.access msg_type 0x%02x unknown RSL msg_discr 0x%02x RSL rx DCHAN: RSL rx IPACC: eeeee e e f f8f4eCopyright (C) 2010-2011 by Harald Welte, Andreas Eversberg and On-Waves Copyright (C) 2011-2022 by sysmocom - s.f.m.c. GmbH License AGPLv3+: GNU AGPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'no rxlev-avg'.%s%% rtp bind-ip is now deprecated%s%*sLower threshold (L_%s_XX_P): %u%s%*sUpper threshold (U_%s_XX_P): %u%s%*sLower threshold comparators: P%u=%02u / N%u=%02u%s%*sUpper threshold comparators: P%u=%02u / N%u=%02u%s%*sPre-processing algorithm: unweighted average%sweighted average%smodified median%sEWMA (alpha=%u)%sdisabled (pass-through)%sunknown%s%*sPre-processing parameters: Hreqave=%u / Hreqt=%u%s%*sPower control interval: %u ms (every %u SACCH block(s))%s%*sPower increase step size: %u%s%*sPower reduce step size: %u%s%*sRxLev measurement processing:%sRXLEV%*sRxQual measurement processing:%sRXQUAL%*sC/I measurement processing (FR/EFR):%sCI_FR%*sC/I measurement processing (HR):%sCI_HR%*sC/I measurement processing (AMR-FR):%sCI_AMR_FR%*sC/I measurement processing (AMR-HR):%sCI_AMR_HR%*sC/I measurement processing (SDCCH):%sCI_SDCCH%*sC/I measurement processing (GPRS):%sCI_GPRS%% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-avg algo osmo-ewma beta %s'.%s%% Range end port (%u) must be greater than the range start port (%u)!%s%% Range must begin at an even port number! (%u is odd)%s%% Range must end at an odd port number! (%u is even)%s%% No such instance %u%s%% Unable to create phy%u instance %u%sphy %u%s%% Unknown BTS number %u (num %u)%s%% No such BTS (%d)%s%% Incorrect BCCH power reduction value, an even number is expected%s%% BCCH carrier power reduction operation mode is not supported for BTS (%d)%s%% can't find BTS '%s'%sinfinite%% INFINITE RADIO LINK TIMEOUT, USE ONLY FOR BTS RF TESTING%sonlyskip-nullrfc5993test message sent from VTY%% phy%s does not exist%s%% phy%s instance %s does not exit%s%% phy%s instance %s is already bound to %s%s%% The next unused TRX number is %u%s%% Unable to allocate TRX %u%svty.c:2337%% This command requires restart%svty.c:2320localhost/opt/poky-oc2g/2.3.4/sysroots/cortexa15hf-neon-poky-linux-gnueabi/usr/local/jenkins-build/inst-osmo-bts-oc2g/include/osmocom/core/utils.h:127%% duplicate BSC (A-Bis/OML) ip address configured ('%s')%sstruct bsc_oml_hostvty.cbsc_oml_hostbsc_oml_host->addrOper '%s', Admin '%s', Avail '%s'%s(null)fall-backfrom BSCconnecteddisconnectedTRX %u of BTS %u is on ARFCN %u%sDescription: %s%s RF Nominal Power: %d dBm, reduced by %u dB, resulting BS power: %d dBm%s BS Power control parameters (%s):%s MS Power control parameters (%s):%s NM State: RSL State: %s%s Baseband Transceiver NM State: IPA stream ID: 0x%02x%sBTS %u, TRX %u, Timeslot %u, phys cfg %s, TSC %u (%s mode)%% can't find TRX '%s'%s%% can't find TS '%s'%ssapi >= 0uint16_tsapi <= 31osmo%% BTS model 'osmo-bts-trx' has no DSP/HW MS Power Control support, consider updating your configuration file!%s%% This BTS model has no DSP/HW MS Power Control support%s%% Could not resolve logical channel%s%% BAND '%s' is not a valid GSM band%svty.c:672%% no such BSC (A-Bis/OML) ip address configured ('%s')%s as %s switching %s -> %sshadowprimaryBTS %u, TRX %u, Timeslot %u (%s) %s, Lchan %u, Type %s, State %s - RXL-FULL-ul: %4d dBm%s%d SACCH blocks%% this channel has no active RTP stream%s%% error setting jitter parameters: %s%s%% jitter parameters set: %d%sbs-power-ctrldynamiccurrent Error reason: staticendisBTS %u, TRX %u, Timeslot %u (%s), Lchan %u: Type %s%s Osmocom Dyn TS: IPACC Dyn PDCH TS: State: %s%s%s%s Channel Mode / Codec: %s%s CSD mode: %s%s AMR Multi-Rate Configuration: ICMI=%u, Start Mode=%u gsm48=%02x%02x%s AMR Mode %u (%s), threshold=%u, hysteresis=%u%s Bound IP: %s Port %u CONN_ID=%u Osmux_CID=%u%s RTP_TYPE2=%u%s Conn. IP: %s Port %u SPEECH_MODE=0x%02x RTP_TYPE=%u%s LAPDm SAPIs: DCCH %c%c, SACCH %c%c%s Valid System Information: 0x%08x%s MS Timing Offset: %d, propagation delay: %d symbols %s Ciphering A5/%u State: %s, N(S)=%u%s RTP/PDCH Loopback Enabled%s Radio Link Failure Counter 'S': %d%s Interference: %d dBm (band %d)%s%*sBS (Downlink) Power Control (%s mode):%s%*sChannel reduction: %u dB (max %u dB)%*sTRX reduction: %u dB%s%*sActual / Nominal power: %d dBm / %d dBm%s%*sPower Control parameters:%s%*sMS (Uplink) Power Control (%s):%s%*sCurrent power level: %u, %d dBm (max %u, %d dBm)%*sACCH repetition:%s%*sEnable RXQUAL threshold: %u%s%*sEnable RXQUAL threshold: (none, alway on)%s%*sDL-FACCH:%s%*sretramsit all LAPDM block types%s%*sretramsit only LAPDM command blocks%s%*sno retransmission (disabled)%s%*sretransmission currently active%s%*sretransmission currently inactive%s%*sDL-SACCH:%s%*sretramsit all SACCH blocks for SAPI=0%s%*sUL-SACCH:%s%*sTemporary ACCH overpower:%s%*sOverpower value: %u dB%s%*sSACCH overpower: %sabled%s%*sFACCH overpower: %sabled%s%*sRxQual threshold: disabled (overpower is always on)%s%*sRxQual threshold: %u%sno ts101318offbts %u%s description %s%s band %s%s auto-band%s ipa unit-id %u %u%s rtp jitter-buffer %u oml remote-ip %s%s adaptive rtp port-range %u %u%s rtp ip-dscp %d%s rtp socket-priority %d%s rtp continuous-streaming%s %srtp internal-uplink-ecu%s rtp hr-format %s%s paging queue-size %u%s paging lifetime %u%suplink %s-power-target %d hysteresis %d %s-power-filtering algo ewma beta %u%s no %s-power-filtering%s agch-queue-mgmt threshold %d low %d high %d%s gsmtap-remote-host %s%s gsmtap-local-host %s%s gsmtap-sapi %s%s gsmtap-rlp skip-null%s gsmtap-rlp%s min-qual-rach %d%s min-qual-norm %d%s max-ber10k-rach %u%s pcu-socket %s%s pcu-socket-wqueue-length %u%s supp-meas-info toa256%s smscb queue-max-length %d%s smscb queue-target-length %d%s smscb queue-hysteresis %d%s%sosmux%s%s use on%sonly%soff%s%s local-ip %s%s%s local-port %u%s%s batch-factor %d%s%s batch-size %u%s%s dummy-padding %s%s trx %u%s user-gain %u mdB%s power-ramp max-initial %d mdBm%s power-ramp step-size %d mdB%s power-ramp step-interval %d%s ms-power-control %s%s ta-control interval %u%s phy %u instance %u%s[BTS %u, RAC %u, NSEI %u, BVCI %u%s Cell NM state: NSE NM state: NSVC%u (NSVCI %u) NM state: Address: r=%s%s%s:%u<->l=%s%s%s:%u%s%% can't find BTS %s%s%% can't find TRX %s%s%% can't find TS %s%s%% can't find LCHAN %s%sBTS %u is of type '%s', in band %s, has CI %u LAC %u, BSIC %u and %u TRX%s Description: %s%s Unit ID: %u/%u/0, OML Stream ID 0x%02x%s Site Mgr NM State: PCU version %s connected%s Paging: Queue size %u, occupied %u, lifetime %us%s AGCH: Queue limit %u, occupied %d, dropped %llu, merged %llu, rejected %llu, ag-res %llu, non-res %llu%s CBCH queue target: %d, hysteresis: %d, maximum: %d%s CBCH backlog queue length (BASIC): %d%s CBCH backlog queue length (EXTENDED): %u%s Paging: queue length %d, buffer space %d%s OML Link state: %s.%s PH-RTS.ind FN advance average: %d, min: %d, max: %d%s Radio Link Timeout (OML): %s%s Radio Link Timeout (OVERRIDE): %s%s BCCH carrier power reduction: %u dB%s TRX %u%s phy %d %s (%s) Features:%s %03u %-40s%s (not available)%s BTS model specific (internal) flags:%s%% Cannot find PHY link number %d%s%% Cannot find PHY instance number %d%sgsmtap-sapi (Enable sending of UL/DL messages over GSMTAP no gsmtap-sapi (Negate a command or set its defaults Disable sending of UL/DL messages over GSMTAP logging filter l1-sapi (Configure logging Filter log messages L1 SAPI no logging filter l1-sapi (Negate a command or set its defaults Configure logging Filter log messages L1 SAPI bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) value (current|max) <0-255>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change current power value Current value (for both dynamic and static modes) Maximum value (for dynamic mode only) BS power reduction (in dB) or MS power level bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) mode (static|dynamic)BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change power control mode Disable the power control loop Enable the power control loop no bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackNegate a command or set its defaults BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackBTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> rtp jitter-buffer <0-10000>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number RTP settings Jitter buffer Size of jitter buffer in (ms) no instance <0-255>Negate a command or set its defaults Select a PHY instance to remove PHY Instance number Select a PHY instance to configure PHY Instance number phy <0-255>Select a PHY to configure PHY number %s(phy-inst)# %s(phy)# no gsmtap-rlpNegate a command or set its defaults Disable generation of GSMTAP frames for RLP (non-transparent CSD) gsmtap-rlp [skip-null]Enable generation of GSMTAP frames for RLP (non-transparent CSD) Skip the generation of GSMTAP for RLP NULL frames gsmtap-sapi (enable-all|disable-all)Enable/disable sending of UL/DL messages over GSMTAP Enable all kinds of messages (all SAPI) Disable all kinds of messages (all SAPI) no gsmtap-local-hostNegate a command or set its defaults Disable local bind for GSMTAP Um logging no gsmtap-remote-hostNegate a command or set its defaults Disable GSMTAP Um logging gsmtap-local-host HOSTNAMEEnable local bind for GSMTAP Um logging (see also 'gsmtap-sapi') Local IP address or hostname gsmtap-remote-host [HOSTNAME]Enable GSMTAP Um logging (see also 'gsmtap-sapi') Remote IP address or hostname ('localhost' if omitted) show lchan summary [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel Short summary BTS Number TRX Number Timeslot Number Logical Channel Number show lchan [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel BTS Number TRX Number Timeslot Number Logical Channel Number show timeslot [<0-255>] [<0-255>] [<0-7>]Show running system information Display information about a TS BTS Number TRX Number Timeslot Number show trx [<0-255>] [<0-255>]Show running system information Display information about a TRX BTS Number TRX Number bts <0-0> c0-power-red <0-6>BTS Specific Commands BTS Number BCCH carrier power reduction operation Power reduction value (in dB, even numbers only) bts <0-0> radio-link-timeout (oml|infinite|<4-64>)BTS Specific Commands BTS Number Manually override Radio Link Timeout Use value provided by BSC via A-bis OML (Connection Failure Criterion) Use infinite timeout (DANGEROUS: only use during testing!) Number of lost SACCH blocks test send-failure-event-report <0-255>Various testing commands Send a test OML failure event report to the BSC BTS Number show bts <0-255> gprsShow running system information Display information about a BTS BTS Number GPRS/EGPRS configuration show bts [<0-255>]Show running system information Display information about a BTS BTS Number phy <0-255> instance <0-255>Configure PHY Link+Instance for this TRX PHY Link number PHY instance PHY Instance numberta-control interval <0-31>Timing Advance Control Parameters Set TA control loop interval As in P_CON_INTERVAL, in units of 2 SACCH periods (0.96 seconds) (default=0, every SACCH block) ms-power-control (dsp|osmo)Mobile Station Power Level Control Handled by DSP Handled by OsmoBTS power-ramp step-interval <1-100>Power-Ramp settings Power increase by step Step time in seconds power-ramp step-size <1-100000> (dB|mdB)Power-Ramp settings Power increase by step Step size Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) power-ramp max-initial <-10000-100000> (dBm|mdBm)Power-Ramp settings Maximum initial power Value Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) user-gain <-100000-100000> (dB|mdB)Inform BTS about additional, user-provided gain or attenuation at TRX output Value of user-provided external gain(+)/attenuation(-) Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) smscb queue-hysteresis <0-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Hysteresis of the SMSCB (CBCH) queue In count of messages/pages (default: 2) smscb queue-target-length <1-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Target length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 2) smscb queue-max-length <1-60>SMSCB (SMS Cell Broadcast) / CBCH configuration Maximum length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 15) no supp-meas-info toa256Negate a command or set its defaults Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods supp-meas-info toa256Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods pcu-socket-wqueue-length <1-2147483647>Configure the PCU socket queue length Queue length pcu-socket PATHConfigure the PCU socket file/path name UNIX socket path max-ber10k-rach <0-10000>Set the maximum BER for valid RACH requests BER in 1/10000 units (0=no BER; 100=1% BER) min-qual-norm <-100-100>Set the minimum link quality level of Normal Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) min-qual-rach <-100-100>Set the minimum link quality level of Access Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) uplink-power-filtering algo ewma beta <1-99>Configure filtering for uplink power control loop Select the filtering algorithm Exponentially Weighted Moving Average (EWMA) Smoothing factor (in %): beta = (100 - alpha) 1% - lowest smoothing, 99% - highest smoothing no uplink-power-filteringNegate a command or set its defaults Disable filtering for uplink power control loop uplink-power-target <-110-0> hysteresis <1-25>Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm Target Rx Level hysteresis Tolerable deviation in dBm Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm agch-queue-mgmt defaultAGCH queue mgmt Reset clean parameters to default values agch-queue-mgmt threshold <0-100> low <0-100> high <0-100000>AGCH queue mgmt Threshold to start cleanup in % of the maximum queue length Low water mark for cleanup in % of the maximum queue length High water mark for cleanup in % of the maximum queue length paging lifetime <0-60>Paging related parameters Maximum lifetime of a paging record Maximum lifetime of a paging record (secods) paging queue-size <1-1024>Paging related parameters Maximum length of BTS-internal paging queue Maximum length of BTS-internal paging queue rtp hr-format (rfc5993|ts101318)RTP parameters HRv1 codec output format RFC 5993 TS 101 318 no rtp internal-uplink-ecuNegate a command or set its defaults RTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream rtp internal-uplink-ecuRTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream no rtp continuous-streamingNegate a command or set its defaults RTP parameters Always emit an RTP packet every 20 ms rtp continuous-streamingRTP parameters Always emit an RTP packet every 20 ms rtp socket-priority <0-255>RTP parameters Specify socket priority for RTP/IP packets The socket priority value (> 6 requires CAP_NET_ADMIN) rtp ip-dscp <0-63>RTP parameters Specify DSCP for RTP/IP packets The DSCP value (upper 6 bits of TOS) rtp port-range <1-65534> <1-65534>RTP parameters Range of local ports to use for RTP/RTCP traffic Port range start (inclusive) Port range end (inclusive) rtp jitter-buffer <0-10000> [adaptive]RTP parameters RTP jitter buffer Jitter buffer in ms Enable adaptive RTP jitter buffering rtp bind-ip A.B.C.DRTP parameters RTP local bind IP Address RTP local bind IP Address no oml remote-ip A.B.C.DNegate a command or set its defaults OML Parameters OML IP Address OML IP Address oml remote-ip A.B.C.DOML Parameters OML IP Address OML IP Address band (450|GSM450|480|GSM480|750|GSM750|810|GSM810|850|GSM850|900|GSM900|1800|DCS1800|1900|PCS1900)Set the frequency band of this BTS Alias for GSM450 450Mhz Alias for GSM480 480Mhz Alias for GSM750 750Mhz Alias for GSM810 810Mhz Alias for GSM850 850Mhz Alias for GSM900 900Mhz Alias for DCS1800 1800Mhz Alias for PCS1900 1900Mhz ipa unit-id <0-65534> <0-255>ip.access RSL commands Set the Unit ID of this BTS Site ID Unit ID bts BTS_NRSelect a BTS to configure BTS Number vty telnet-port <0-65535>Configure the VTY Set the VTY telnet port TCP Port number trx <0-254>Select a TRX to configure TRX number dummy-padding (on|off)Dummy padding Enable dummy padding Disable dummy padding (default) batch-size <1-65535>Batch size Batch size in bytes batch-factor <1-8>Batching factor Number of messages in the batch local-port <1-65535>Osmux port UDP port local-ip (A.B.C.D|X:X::X:X)IP information IPv4 Address to bind to IPv6 Address to bind to use (off|on|only)Configure Osmux usage Never use Osmux Use Osmux if requested by BSC (default) Always use Osmux, reject non-Osmux BSC requests osmuxConfigure Osmux no auto-bandNegate a command or set its defaults Automatically select band for ARFCN based on configured band auto-bandAutomatically select band for ARFCN based on configured band %s(osmux)# %s(trx)# %s(bts)# OsmoBTSThis command applies for newly created lchansThis command applies when the TRX powercycles or restartsBSC Send PAGING for group %u, but number of paging sub-channels is only %u paging.cDropping paging, queue full (%u) Ignoring duplicate paging struct paging_recordpaging.c:254Add paging to queue (group=%u, queue_len=%u) Dropping paging for PS, queue congested (%u) short IMSI (%zu digits), will assume "000" to calculate paging group Add MAC block to paging queue (group=%u) etws_len < 128/8Paging called for GSM wrong time: FN %d/%d/%d/%d. paging.c:738Tx PAGING TYPE 3 (4 TMSI) Tx PAGING TYPE 2 (2 TMSI,1 xMSI) Tx PAGING TYPE 1 (1 xMSI,1 empty) Tx PAGING TYPE 1 (2 xMSI) paging.c:823Removed paging record, queue_len=%u Paging SI update struct paging_statepaging.c:904num_paging != 0 after flushing all records?!? ZZ &&@@gg33MMZg &3@MBFJNbX\ %s %s Unsupported lchan->tch_mode %u measurement.c%s %s meas period end fn_mod:%d, status:%d, pchan:%s SUBFULL%s %s measurement during state: %s, num_ul_meas=%d, fn_mod=%u %s %s no space for uplink measurement, num_ul_meas=%d, fn_mod=%u %s %s adding a %s measurement (ber10k=%u, ta_offs=%d, ci_cB=%d, rssi=-%u), num_ul_meas=%d, fn_mod=%u %s Calculating measurement results for physical channel: %s %s Received %u UL measurements, expected %u %s Received %u excess UL measurements %s Replaced %u measurements with dummy values, from which %u were SUB measurements %s Received UL measurements contain %u SUB measurements, expected at least %d %s Incorrect number of SUB measurements detected! (%u vs exp >=%d) %s Received UL measurements contain %u SUB measurements, expected %d %s Incorrect number of SUB measurements detected! (%u vs exp %d) %s Computed TA256(% 4d), BER-FULL(%2u.%02u%%), RSSI-FULL(-%3udBm), C/I-FULL(% 4d cB), BER-SUB(%2u.%02u%%), RSSI-SUB(-%3udBm), C/I-SUB(% 4d cB) %s UL MEAS RXLEV_FULL(%u), RXLEV_SUB(%u), RXQUAL_FULL(%u), RXQUAL_SUB(%u), num_meas_sub(%u), num_ul_meas(%u) i < lchan->meas.num_ul_meassq_diff_sum <= UINT32_MAXinactive => activeactive => inactive%s Temporary ACCH overpower: %s %s DL-FACCH repetition: inactive => active %s DL-FACCH repetition: active => inactive % -%s AMR MR Conf: num_modes=%uamr.c, mode[%u] = %u/%u/%uAMR CMI %u not part of AMR MR set RTP->L1: overriding CMR %u AMR Multirate IE is too short (%u) AMR Multirate Version %u unknown AMR Multirate with %u modes len=%u not possible %s T3115 timeout (%d resends left) asci.c%s is not active. It is in state %s. Ignoring %s NY2 reached, sending CONNection FAILure to BSC. %s VGCS RACH on dedicated channel type %s received with TA=%u, ref=%u %s Ignoring RACH, there is an active talker already. %s Failed to deactivate uplink access after TALKER DET. %s Starting T3115 with %u ms %s Channel is activated. %s Failed to activate uplink access after channel activation. %s Channel is activated for assignment. %s Failed to deactivate uplink access for assignment. %s First valid frame detected, talker now active. %s Uplink released, no talker. %s Failed to activate uplink access after uplink became free. 78808D8667747L7d7|77 777777lchan.clchan_nr == 0lchan_nr < 2lchan_nr < 4lchan_nr < 8ts=%u,ss=%u Physical channel %s not expected! ts=%u,ss=%u Physical channel %s (0x%02x) not expected! (bts=%u,trx=%u,ts=%u%s,ss=%u)lchan.c:161%s Setting T200 D0=%u, D3=%u, S0=%u, S3=%u (all in frames) lchan%s SACCH no SI available %s state %s -> %s Closing RTP socket on Channel Release %s: PDCH release requested but already in switchover %s Not enough room to store interference report (%ddBm) meas_num > 0%s Interference AVG: %ddBm (band %d, samples %u) %s Rx RSL IPAC CRCX, but we already have socket! %s IPAC Failed to create RTP/RTCP sockets %s IPAC Failed to create RTP/RTCP sockets%s IPAC Failed to set RTP socket parameters: %s %s IPAC set RTP socket parameters: %d failed to set DSCP=%d: %s failed to set socket priority %d: %s %s IPAC Failed to bind RTP/RTCP sockets %s IPAC Failed to bind RTP/RTCP socketsbts@%sOsmoBTS-1.8.0.29-b032%s Failed to connect RTP/RTCP sockets %s IPAC cannot obtain locally bound IP/port: %d %s freeing %d queued frames non-transparenttransparent @ 1200/75 bpstransparent @ 600 bpstransparent @ 1200 bpstransparent @ 2400 bpstransparent @ 4800 bpstransparent @ 9600 bpstransparent @ 14400 bpstransparent @ 29000 bpstransparent @ 32000 bpsRX_REQRX_CONFRXTX_REQRX_CONF_TX_REQRXTX_CONFACTIVATION REQUESTEDACTIVERELEASE REQUESTEDRELEASE DUE ERRORBROKEN UNUSABLEeef@f8fBB %s not (yet) provisioned pcu_sock.cA transceiver with ARFCN %u is not (yet) provisioned PCU socket has LOST connection PCU socket has LOST connectionmsgb_length(msg) > 0pcu_sock_txPCU socket not created, dropping message PCU socket not connected, dropping message PCU not reacting (more than %u messages waiting). Closing connection Sending info BTS is up BTS is down %s PCU interface (version %u) cannot handle more than %zu transceivers => skipped %s unavailable for PCU (op=%s adm=%s) %s PDCH on ts=%u is available (tsc=%u hopping=yes hsn=%u maio=%u ma_bit_len=%u) hopping=no arfcn=%u) Failed to accept a new connection PCU connects but we already have another active connection ?!? Failed to register new connection fd PCU socket connected to external PCU Sending rts request: is_ptcch=%d arfcn=%d block=%d Sending data indication: sapi=%s arfcn=%d block=%d data=%s Updating SI%s to PCU: %s Revoking SI%s from PCU Failed to send SI%s to PCU: rc=%d OsmoPCU version %s connected SI%s is not available on PCU connection Unknown TXT_IND type %u received ActivateDeactivatepcu_sock_rxReceived %d bytes on PCU Socket, but primitive hdr size is %zu, discarding Received %zu bytes on PCU Socket, but primitive %s size is %zu, discarding pcu_prim->u.data_reqReceived PCU Prim for non-existent BTS %u Data request received: sapi=%s arfcn=%d block=%d data=%s Rx malformed DATA.req for PCH pcu_agchReceived PCU data request with not existing TRX %d Received PCU data request with not existing TS %u %s: Received PCU DATA request for non-PDCH TS %s: Received PCU DATA request for inactive lchan Received PCU data request with unsupported sapi %d pcu_prim->u.pag_reqPaging request received: chan_needed=%d length=%d (dropping message because support for PCU_IF_MSG_PAG_REQ is not yet implemented) pcu_prim->u.act_req%s request received: TRX=%d TS=%d %s request, but lchan is not of type PDTCH (is %s) %s request, but lchan in dyn TS is not configured as PDCH in lower layers (is %s) pcu_prim->u.txt_indpcu_prim->u.containerReceived %zu bytes on PCU Socket, but primitive container size is %zu, discarding Received unknown PCU msg type %d Sending RACH indication: qta=%d, ra=%d, fn=%d Paging identity too large (%d) PCU socket not created, ignoring paging message Sending DATA.cnf: sapi=%s msg_id=%08x struct pcu_sock_stateCould not create %s unix socket: %s pcu_sock.c:1240Could not register listen fd: %d pcu_sock.c:1251Started listening on PCU socket (PCU IF v%u): %s pcu_sock.c:1279PCH_2AGCH_2PHYS INFO%s Sending PHYSICAL INFORMATION to MS. handover.c%s T3105 timeout (%d resends left) %s is in not active. It is in state %s. Ignoring %s NY1 reached, sending CONNection FAILure to BSC. %s RACH on dedicated channel received, but ra=0x%02x != expected ref=0x%02x. (This is no bug) %s handover RACH received on %s?! %s RACH on dedicated channel type %s received with TA=%u, ref=%u %s failed to modify channel after handover %s Starting T3105 with %u ms %s First valid frame detected BDFH468:456789:;Incorrect OM hdr length value %d %zu msg_utils.cFOM header insufficient space %zu %zu %s failed to decode AMR RTP (length %zu, %p) %s unsupported AMR FT 0x%02x %s Have to send %s frame on TCH but SID buffer is empty - sent nothing Ipa header insufficient space %d %zu Incorrect ipa header msg size %d %zu IPA length shorter than OSMO header Om header insufficient space %d %zu Incorrect om mdisc value %x Incorrect om placement value %x %x Incorrect om sequence value %d No ManId Length Indicator %zu Insufficient message space for this ManId Length %d %zu Manuf Label Unknown %s ramp_timer_cb(cur_pout=%d, tgt_pout=%d, ramp_att=%d, therm_att=%d, user_gain=%d) tx_power.c%s ramping TRX board output power to %d mdBm. %s bts_model notifies us of %d mdBm TRX output power. However, it should be %d mdBm! , bypass%s power_ramp_start(cur=%d, tgt=%d%s) %s Asked to ramp power up to %d mdBm, which exceeds P_max_out (%d) %s target_power (%d mdBm) is below or equal to 'power ramp max-initial' power (%d mdBm) tLLL%s{%s}: Timer expired waiting for ramp down complete bts_shutdown_fsm.c%s{%s}: Timer expired waiting for TRX close %s{%s}: %s TRX closed, %u TRX remaining %s{%s}: %s Ramping down complete, %u TRX remaining %s{%s}: No TRX is operational, skipping power ramp down %s{%s}: Shutdown process completed successfully, exiting process osmo_fsm_register(&bts_shutdown_fsm) == 0%s{%s}: BTS is already being shutdown. %s{%s}: Shutting down BTS, exit %u, reason: %s fi=NULL%s{%s}: %s Received TRX close cb rc=%d BTS_SHUTDOWNBTS_SHUTDOWN_EV_STARTBTS_SHUTDOWN_EV_TRX_RAMP_COMPLBTS_SHUTDOWN_EV_TRX_CLOSEDWAIT_RAMP_DOWN_COMPLWAIT_TRX_CLOSEDEXIT++++++++++++++++++++!+++++++++++++++++(P@(P@l1sap_rtp_rx_cb ee4eeeef f f f e f0f(f@f8feeeeee%s RTP clock out of sync with lower layer: %u vs %d (%u->%u) l1sap.c%s Ignoring an Access Burst on %s: BER10k(%u) > BER10k_MAX(%u) %s Ignoring an Access Burst on %s: ToA(%d) exceeds the allowed range (%d..%d) %s Ignoring an Access Burst on %s: link quality (%d) below the minimum (%d) %s radio link timeout counter S is already 0 %s decreasing radio link timeout counter S=%d -> %d %s radio link timeout counter S reached zero, dropping connection %s increasing radio link timeout counter S=%d -> %d rc >= 0GSMTAPMPH INFOTCHDATA%s %s %s meas ind, ta_offs_256bits=%d, ber10k=%d, inv_rssi=%u, C/I=%d cB %s assuming active lchan, but state is %s l1sap_prim%s No lchan for PH-RTS.ind (chan_nr=%s) %s %s Rx TCH-RTS.ind bits_per_20ms != 0%s %s Tx TCH.req %s %s DL TCH Tx queue underrun msgb_l2len(msg) == 240%s %s Invalid TCH mode in TCH-RTS.ind under CSD NT PH-RTS-IND%s BTS model is sending us PRIM_INFO_TIME for TRX %u, please fix it %s Rx MPH_INFO time ind %s Invalid condition detected: Frame difference is %u-%u=%u > 1! %s No lchan for chan_nr=%s unknown MPH_INFO ind type %d %s get_lchan_by_chan_nr(chan_nr=%s) yields NULL for PRIM_INFO_ACTIVATE.conf %s activate confirm chan_nr=%s trx=%d %s deactivate confirm chan_nr=%s trx=%d unknown MPH_INFO cnf type %d %s Rx PH-RTS.ind chan_nr=%s link_id=0x%02xd %s RTS without msg to be reused. Please fix! %s %s no looped PDTCH message, sending empty %s %s looped PDTCH message of %u bytes %s %s Forward RLL RELease INDication to the BSC %s DL-SACCH repetition: inactive => active %s DL-SACCH repetition: active => inactive rep_sacchrep_facch_0rep_facch_1%s Tx PH-DATA.req chan_nr=%s link_id=0x%02x %s Rx PH-DATA.ind chan_nr=%s link_id=0x%02x len=%d %s There can be no DATA.ind on PTCCH/U. This is probably a bug of the BTS model you're using, please fix! %s UL-SACCH repetition: inactive => active %s UL-SACCH repetition: active => inactive %s %s Lost SACCH block %s No lchan for TCH.ind (chan_nr=%s) %s %s Rx TCH.ind msg->len == GSM_HR_BYTES%s %s Skipping RTP frame with lost payload %s Rx PH-RA.ind %s Access Burst for continuous Timing Advance control (toa256=%d) %s Access Bursts on PDTCH/U are not (yet) supported %s Attempting to set invalid Timing Offset value %d (MS TO = %u)! %s RACH for packet access (toa=%d, ra=%d) %s RACH for RR access (toa=%d, ra=%d) unknown prim %d op %d%s Rx -> RTP: %s TX packet data %s is_ptcch=%d trx=%d ts=%d block_nr=%d, arfcn=%d, len=%d %s %s(): incoming RTP truncated: %u -> %u -shadow%s Trying to activate already active channel %s %s Activating channel %s bts%u-trx%u-ts%u-ss%u%s%s Trying to deactivate already deactivated channel %s %s Deactivating channel %s %s Deactivating SACCH on channel %s %s Modifying channel %s ActivatingDeactivating%s Channel %s is not an active ASCI type channel. %s %s uplink access detection on channel %s \\\\select_next_smscbcbch.c:327cbch.c:333cbch.c:335cbch.cCBCH-EXTENDEDCBCH-BASIC%s %s: No cur_msg; requesting NULL block %s %s: cur_msg has only %u blocks; requesting NULL block to_copy >= 0%s %s: deleting fully-transmitted message %p cbch.c:148%s %s: keeping fully-transmitted default message %p %s: Cannot process SMSCB of %u bytes (max %zu) struct smscb_msgRSL SMSCB COMMAND (chan=%s, type=%s, num_blocks=%u) RSL SMSCB COMMAND (chan=%s, type=%s): OVERFLOW cbch.c:223cbch.c:235cbch.c:242cbch.c:246%s: %s: Dequeued msg %s: %s: Using default msg %s: %s: No queued msg nor default NORMALSCHEDULEDEFAULTNULL &2    RaisingLowering%s Failed to calculate dBm for power ctl level %u on band %s power_control.c%s Failed to retrieve power level for %d dBm on band %d %s Keeping MS power at control level %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s %s MS power control level %d (%d dBm) => %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s Rx DL Measurement Report: RXLEV-FULL(%02u), RXQUAL-FULL(%u), RXLEV-SUB(%02u), RXQUAL-SUB(%u), DTx is %s => using %s %s Keeping DL attenuation at %u dB: max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] %s %s DL attenuation %u dB => %u dB:max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] $ih,id4iD@icLis\iThiVpie|iiitiriTn iTn iTn signal %u received BTS: SIGINT received -> shutdownSIGINTOsmoBTS contextsum-hc:d:Dc:sTVe:i:t:r:Some useful options: -h --help this text -d --debug MASK Enable debugging (e.g. -d DRSL:DOML:DLAPDM) -D --daemonize For the process into a background daemon -c --config-file Specify the filename of the config file -s --disable-color Don't use colors in stderr log output -T --timestamp Prefix every log line with a timestamp -V --version Print version information and exit -e --log-level Set a global log-level VTY reference generation: --vty-ref-mode MODE VTY reference generation mode (e.g. 'expert'). --vty-ref-xml Generate the VTY reference XML output and exit. Regression testing: --vty-test VTY test mode. Do not connect to BSC, do not exit.%s: Unknown VTY reference generation mode '%s' Generating the VTY reference in mode '%s' (%s) %s: error parsing cmdline options Command line argument '-r' is deprecated, use VTY cpu-sched node setting 'policy rr %d' instead. Command line argument '-i' is deprecated, use VTY parameter 'gsmtap-remote-host %s' instead. Command line argument '-t' is deprecated and does nothing, TRX number is calculated from the VTY automatically. ((*)) | / \ OsmoBTS --- VTY test mode: not connecting to BSC, not exiting --- Failed to create BTS Site Manager structure Failed to create BTS structure Setting SCHED_RR priority(%d) failed: %s unable to open bts Failed to parse the config file: '%s' You need to configure at least phy0 TRX %u has no associated PHY instance Command line argument '-i %s' overrides 'gsmtap-remote-host %s' from the config file main.c:356Setting up GSMTAP Um forwarding '%s'->'%s:%u' Failed during gsmtap_source_init2() Error initializing telnet PCU L1 socket failed Osmux setup failed osmo-btsunable to open PHY link(s) Error during daemonizehelpdebugdaemonizeconfig-filedisable-colortimestampversionlog-levelgsmtap-iptrx-numrealtimevty-ref-modevty-ref-xmlvty-testosmo-bts.cfgakstruct phy_linkphy%u%s: PHY link state change %s -> %s phy_link.cstruct phy_instancepinst->trx == NULLpinst->trx->pinst == pinstphy_link.c:139phy_link.c:149phy%u.%u%s: This PHY instance is not associated with a TRX instance, check the configuration file! connectingkkkkkkkkdtx_dl_amr_fsm.cUnexpected event %d Inexpected event %d DTX_DL_AMR_FSMVoiceONSETFACCHCompleteFIRST P1->P2InhibitSID-FIRSTSID-UPDATESID-FIRST (P1)SID-FIRST (P2)SID-FIRST (Inh, SPEECH)SID-FIRST (Inh, FACCH)SID-UPDATE (Inh, SPEECH)SID-UPDATE (Inh, FACCH)SID-UPDATE (NoInh)SID-FIRST (Inh, SPEECH, Rec)SID-FIRST (Inh, FACCH, Rec)SID-UPDATE (Inh, SPEECH, Rec)SID-UPDATE (Inh, FACCH, Rec)SID-UPDATE (AMR/HR)ONSET (SPEECH)ONSET (FACCH)ONSET (SPEECH, Rec)ONSET (FACCH, Rec)3fD ff f$,hDh$DhDh$DhD h$D@hDh$DhP h$P0h{Ph$uPhnx                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                $$$$%%%%&&&&    """"    """"####$$$$%%%%&&&&####$$$$%%%%&&&&    !!!!""""    !!!!""""####$$$$%%%%&&&&####                                                               BCCH+CCCHBCCH+CCCH+SDCCH/4+SACCH/4BCCH+CCCH+SDCCH/4+SACCH/4+CBCHSDCCH/8+SACCH/8SDCCH/8+SACCH/8+CBCHTCH/F+SACCHTCH/H+SACCHlateearly%s Keeping current TA at %u: TOA was %d ta_control.c%s %s TA %u => %u: TOA was too %s (%d) nm_bts_sm_fsm.cosmo_fsm_register(&nm_bts_sm_fsm) == 0NM_BTS_SM_OPDISABLED_NOTINSTALLEDDISABLED_OFFLINEENABLEDnm_bts_fsm.cnm_bts_fsm.c:66osmo_fsm_register(&nm_bts_fsm) == 0NM_BTS_OPnm_bb_transc_fsm.c rsl phy opstart%s{%s}: Not connecting RSL in OML-DUMMY! %s{%s}: Error connecting IPA RSL: %d %s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s nm_bb_transc_fsm.c:63osmo_fsm_register(&nm_bb_transc_fsm) == 0NM_BBTRANSC_OPnm_channel_fsm.c%s{%s}: BSC trying to activate TS while still in avail=dependency. Allowing it to stay backward-compatible with older osmo-bts versions, but BSC is wrong. nm_channel_fsm.c:62osmo_fsm_register(&nm_chan_fsm) == 0NM_CHAN_OPDISABLED_DEPENDENCYnm_gprs_cell_fsm.cosmo_fsm_register(&nm_gprs_cell_fsm) == 0NM_GPRS_CELL_OPnm_gprs_nse_fsm.cosmo_fsm_register(&nm_gprs_nse_fsm) == 0NM_GPRS_NSE_OPnm_gprs_nsvc_fsm.cosmo_fsm_register(&nm_gprs_nsvc_fsm) == 0NM_GPRS_NSVC_OPnm_radio_carrier_fsm.c setattr%s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s%s nm_radio_carrier_fsm.c:52osmo_fsm_register(&nm_rcarrier_fsm) == 0NM_RCARRIER_OPstruct asci_notificationAdded ASCI Notification for group call reference %s notification.cDeleting ASCI Notification for group call reference %s notification.c:91Deleting all %u ASCI Notifications of BTS notification.c:109gcr_bvchd_bv^ DRSLA-bis Radio Siganlling Link (RSL)DOMLA-bis Network Management / O&M (NM/OML)DRLLA-bis Radio Link Layer (RLL)DRRLayer3 Radio Resource (RR)DMEASRadio Measurement ProcessingDPAGPaging SubsystemDL1CLayer 1 Control (MPH)DL1PLayer 1 Primitives (PH)DDSPDSP Trace MessagesDPCUPCU interfaceDHOHandoverDTRXTRX interfaceDLOOPControl loopsDABISA-bis Intput SubsystemDRTPRealtime Transfer ProtocolDOSMUXOsmux (Osmocom RTP multiplexing)DASCIASCI (Advanced Speech Call Items: VGCS/VBS)OML link was closed early within %llu seconds. If this situation persists, please check your BTS and BSC configuration files for errors. A common error is a mismatch between unit_id configuration parameters of BTS and BSC. abis.cevent == ABIS_LINK_EV_SIGN_LINK_DOWNE1L(%u) Signalling link down OML Signalling link up RSL Signalling link for TRX%d up TRX%d does not exist! Input Signal %s received for ts-%u-%u link_type=%s %s{%s}: List of BSCs to connect to is empty! priv->current_bsc%s{%s}: BTS is shutting down, delaying A-bis connection establishment to BSC %s{%s}: No BSC available, A-bis connection establishment failed A-bis connection establishment to BSC (%s) in progress... eth0ipaevent == ABIS_LINK_EV_VTY_RM_ADDRDrop Tx OML msg, OML link is down msg->trxCannot determine remote IP Addr: %s sin.sin_family == AF_INETNo BSC configured, cannot start BTS without knowing BSC OML IP abis_linkbts->abis_link_fistruct abis_link_fsm_privabis_link_fsm_privosmo_fsm_register(&abis_link_fsm) == 0WAIT_RECONNECTCONNECTINGCONNECTEDFAILEDSIGN_LINK_OML_UPSIGN_LINK_DOWNVTY_RM_ADDRIPA/ABIS/OSMOOSMO message too short ABIS_OSMO_PCU message too short abis_osmo.cRx BSC->BTS%d ABIS_OSMO_PCU msg type %u OSMO message unknown extension %u Releasing unused osmux handle for %s osmux.cosmux.c:155osmux.c:156Cannot find Osmux input handle %p osmux sendto(%s) failed: %s OSMUXcannot allocate message cannot receive message Cannot find lchan for %s CID=%d %s received RTP frame too short (len = %d) Osmux CID %u is back to the pool 127.0.0.1*Failed binding Osmux socket to %s:%u Osmux socket listening on %s:%u All Osmux circuits are in use! Allocating Osmux CID %u from pool lchan->abis_ip.osmux.useosmux.c:448lchan->abis_ip.connect_ip != 0lchan->abis_ip.connect_port != 0Using existing OSMUX handle for rem_addr=%s osmux.c:179Created new OSMUX handle for rem_addr=%s %s Cannot allocate input osmux handle %s Cannot open osmux circuit %u struct osmux_handle%s RTP->L1: Dropping unexpected AMR encoding (bw-efficient?) %s rtp_input_preen.ccsd_rlp.cdata_len == 120data_len == 290<<$$csd_v110.clchan->tch_mode < ARRAY_SIZE(csd_v110_lchan_desc)data_len == CSD_V110_NUM_BITS(desc) (4@L\l|     SW_ACTRX_SETATTRRX_OPSTARTOPSTART_ACKOPSTART_NACKSHUTDOWN_STARTSHUTDOWN_FINISHOML_UPRSL_UPRSL_DOWNPHYLINK_UPPHYLINK_DOWNDISABLEBBTRANSC_ENABLEDBBTRANSC_DISABLEDRCARRIER_ENABLEDRCARRIER_DISABLEDWrite Only attributeValue is out of rangeOK%uOOMset_therm_att(trx=%p, tpp=%p) max-ber10k-rachoml-alertthermal-attenuationg$ePaaa(bpbbcHcccdHZh! U DR V ,4 o8) V @  lHlGo\FooC> PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRdd lddTl L  < <؄4h T00̊t8Lp4dee f$e``xH t|H ,Գ8xdtddddddd PL $C(TlCBl T< &#0 |< d  8,PtpTPLpPl 8,P0P \ $@HplP lM44LL @<dp 0< TM $Lx 0"0"(#X"l"! JzL 7ExS 6 , C    h     $ ( , n0 t4 i,8  ,< @ \D jF zG H !P )SX q*S\ +S` ,Sd .3h /,l 1p z n 7n 7t b,=  6  ' ; <=tttt,   , y 66M,aaag "t $t #k 1, 6,H :,  .  , 0  ,  ,/ *>9 /&,;a 6G,  ;> c!\ (   $ M  (U  P !"G#O$%#& ' ()\* +,- . /] 0 12G3i 45X6789:; < = > ?@A B CxDExFG=H IVJKLMN OPQR+ST4U=VFWXYZ [\ ]N^X_-`6 a b cd e f$ghq %  H  @ -  >\> @U   zr     { P  ! E Gd P,7 Q, u R TR W, Y Ac&> M!s v> TK`@g \ I ^ - _rev `,  a! b bK { c n, > i T`lx*> l. 9 f  W !@    , ,  ,p ,p , , , , ,b , , , , , , ,O , ,` ,+ ,= , ,h ,O ,S , , , , , =     > 4  3  L0   > , uUX z,{>~E%  z  lowh h  s ll~    c     p  XQ@Rn d rpR!nn !dd !rr "d0s "d1s "n0s `"n1s "n2s "q0s "q1s @"bs "bms !ww #( $ 6s $ 6s $P 6s 5$K 6s k$ 6s $ 6s "__m6s #$ [s +$ [s >$P [s Q$K [s |$ [s $ [s "__m[s %lT$ `s $ `s 2$P `s K$K `s v$ `s $ `s "__m`s &@"m1s "m0s _#X:$ s $ s $P s $K s  $ s < $ s r "__ms &x$   b =%Uint<, \\b w % w w}S (Q *Q %,Q .Q 0 }1 m_VCU}C% Cw- 8CwK V7w U,siW, UPvQwRxU}7[z../sysdeps/arm/crtn.S/usr/src/debug/glibc/2.25-r0/git/csuGNU AS 2.28.0%% $ > $ > &I4: ; I?U%%%% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8  : ; : ;I.?: ;'I@B: ;I : ;I!4: ;I"4: ;I# U$4: ;I% & U% $ > : ; I&I$ > I! I ' I 4: ; I?< ' .?: ; '@B.?: ; '@B: ; I4: ; I 4: ; IB1.?<n: ; U%U- ../sysdeps/armstart.S d/1/11.11/22q.4/HB /usr/src/debug/glibc/2.25-r0/git/csuinit.ch, ../sysdeps/armcrti.S\d?/0////DR0 Vh ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armbpabi.S QL/gl ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.SHQ  .//vz ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc-native/usr/lib/arm-poky-linux-gnueabi/gcc/arm-poky-linux-gnueabi/6.4.0/include/usr/include/bits/usr/include../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../include/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/gcc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.hXQ0P. .v. .u.f0.0j0P-//-2 </fM-0mRNf/ J1-0,11+1d0<<K0,L. hK/-0/L0J0/2,-1G1<<O<<VfXmNfI/ ) /usr/src/debug/glibc/2.25-r0/git/csu/usr/src/debug/glibc/2.25-r0/recipe-sysroot-native/usr/lib/arm-poky-linux-gnueabi.gcc-cross-initial-arm/gcc/arm-poky-linux-gnueabi/6.4.0/includeelf-init.cstddef.hU.n.n.Jn..1KgI/eL P, ../sysdeps/armcrtn.SLR/$V7 |  Q<TH | ,HQD | 8TXQ@D$  BBBBB | 4UB rBBBBB Vlong long intlong long unsigned int/usr/src/debug/glibc/2.25-r0/git/csuunsigned char/usr/src/debug/glibc/2.25-r0/git/csu/init.cGNU C11 6.4.0 -march=armv7ve -marm -mfpu=neon -mfloat-abi=hard -mcpu=cortex-a15 -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -ftls-model=initial-execshort unsigned int_IO_stdin_usedshort intsizetypearm710tarm_arch_iwmmxt_shortbufARM_EQ_IO_lock_tarm600program_invocation_short_namestderrarm2__udivmoddi4arm6arm_fp_modelARM_PCS_AAPCS_IWMMXToptoptarm9BASE_ARCH_0BASE_ARCH_2BASE_ARCH_3BASE_ARCH_4BASE_ARCH_5BASE_ARCH_6BASE_ARCH_7cortexa15cortexa7fa606te_IO_write_endhighvfp_reg_typefmp626getdate_errUSItype_flagsarm610arm10e_cur_columnarm9ecortexa72cortexa53arm_ccfsm_statearm1022efa626cortexm0plussmallmultiply__clz_tabARM_VCarm_arch_xscalearm7tdmiscortexm0plus_IO_buf_endARM_VSARM_GEarm_tune_strongarmarm7complex floatARM_GTarm620regscortexa5cortexa8cortexa9__timezoneBASE_ARCH_7EMhashval_tBASE_ARCH_6KZarm740tarm_arch_arm_hwdiv_posarm_fpu_descstdoutall_fpus_IO_save_endopterrfa626tearm7dmistrongarm110BASE_ARCH_3Mmpcorenovfparm9tdmiarm_cond_codeARM_PCS_AAPCS_IO_backup_baseARM_PCS_AAPCS_LOCALarm_fpu_feature_setcortexr4cortexr5cortexr7cortexr8arm_arch_iwmmxt2VFP_NONE_fileno__pad2arm1156t2fs_sys_nerrprefer_neon_for_64bitscortexr4fsize_t_vtable_offset_markerscortexa12unspecv_stringscortexa15cortexa17_IO_read_basearm_arch3marm940tstdinarm920BASE_ARCH_4T_nextarm_regs_in_sequencereturn_used_this_functionBASE_ARCH_5TE_IO_markerarm1176jzfs_chainarm_lang_output_object_attributes_hookarm720tBASE_ARCH_5Earm7500fe_IO_2_1_stderr_processor_typearm_pcs_modearm_arch4tstrongarm1100arm700arm_tune_wbufhtab_hash_IO_read_ptrGNU C11 6.4.0 -march=armv7ve -marm -mfpu=neon -mfloat-abi=hard -mcpu=cortex-a15 -mtls-dialect=gnu -g -g -g -O2 -O2 -O2 -feliminate-unused-debug-types -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hiddenarm_arch_namecortexa32cortexa35arm_arch_notmarm_arch5eARM_LEBASE_ARCH_6JBASE_ARCH_6KBASE_ARCH_6MARM_LSARM_LT_IO_write_basestrongarm1110BASE_ARCH_6Zarm926ejsarm710_IO_2_1_stdin_arm_fpu_attr_IO_2_1_stdout__IO_save_basehtab_hash_pointerBASE_ARCH_5T__q0__q1arm7500arm968esBASE_ARCH_7AARM_FP_MODEL_UNKNOWNARM_MIarm_arch6karm_arch6mBASE_ARCH_7Rarm10tdmiarm920tarm720arm1136jshtab_eq__pad1arm946es__pad3__pad4__pad5__r0__r1ARM_PCS_AAPCS_VFParm_arch_no_volatile_cecortexa57BASE_ARCH_8Aarm700iARM_NEarm60featuresoptindARM_HIprogram_invocation_nameoptargARM_NVarm_arch4cortexm0smallmultiplyarm_arch6arm_arch7arm_arch8long doublecortexa57cortexa53/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/libgccarm_tune_xscalearm_arch5DWstructcortexa17cortexa7arm7di__quad_tmaking_const_tablethumb_call_via_labelarm1156t2s_IO_read_end__d0__d1ARM_PCS_APCSARM_PCS_ATPCScomplex doublearm922tarm_cc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/libgcc2.cunspec_stringsmpcorebase_architecturearm_arch_crc__t0arm1176jzsarm_current_ccfa526cortexa72__environarm966es_IO_FILE_plus__popcount_tabARM_PLDWunionmarvell_pj4BASE_ARCH_6T2BASE_ARCH_5TEJarm_tune_cortex_a9ARM_ALBASE_ARCH_7Marm_target_labelarm_target_insnarm250_lockxgene1pool_vector_labelarm1026ejs_old_offset_IO_FILEarm1136jfs_dont_use_rtx_here_arm70exynosm1UQItypeVFP_REG_D16arm_tunearm_cpp_interworkarm7d__tzname_sbufcortexm1smallmultiplyarm_arch_thumb_hwdiv_IO_write_ptrARM_FP_MODEL_VFPhtab_eq_pointerarm7marm_pic_registerfa726teARM_CCarm_ld_schedarm810ARM_CSVFP_REG_SINGLEarm7dm__off_tgenericv7aarm_base_arch_sys_errlistarm_arch7emarm7100arm_pcs_defaultVFP_REG_D32ARM_PCS_UNKNOWNep9312arm3arm_arch_thumb2cortexm0cortexm1arm8cortexm3cortexm4arm7tdmicortexm7UDItype_flags2arm_none__daylightarm1020earm710cqdf24xx_unused2_IO_buf_basearm_arch8_1arm1020t__off64_t__init_array_startenvp/usr/src/debug/glibc/2.25-r0/git/csu/elf-init.c__libc_csu_fini__fini_array_endsize__preinit_array_start__fini_array_startargcGNU C11 6.4.0 -march=armv7ve -marm -mfpu=neon -mfloat-abi=hard -mcpu=cortex-a15 -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -fPIC -ftls-model=initial-exec__libc_csu_initargv__preinit_array_end__init_array_endPQ%PQ % |PQ|H%HxPQx%PQ4%4<PQ<@%lRSl%RS % 8RS8H%HRS%RS% RS 4%4@RS HRHUR 8R@HXHTRTU R 4X4@R `SS SHdS(S4@S TPT\\P \P\,R,HQHxPt\\P\  \ 4R4<P<@\TQThWQ LQL\8\HQ$RQR Q  W 4\4@Q@`[`dqu%lTP0HPP 1 4P4@000H01  04@00HU 4U8V$ TXV4TXXX\Qu u dxTxtTTPpP\hwxpSRrx\|u"\lRQQWXSsSTtTtwRrwQqu"QPu@%u 4Y4TyXYh|P|pP$rw,lQ`lqwt|\||u"\(hPpXZWHZ 0W04SVHY 0V04Y\HW 4W\Zs  (s \pYpyYPpP\`{w`d qu%whVvw\|s",\ 4\dQZHVW 4VW/P/lVlP/Q/W/R/pXpR8<u2&<U8D0DPTP\t\dT\ddDRLR V$VT,H 4DHLX\lpxLRPR$V(VTp8)C\FlG lH DR PR (a V(V 4 8 < > @ D `  !"#p; d Pd 2(VD >;\d \d xd ;DR ; V;LR ;$V; |  ;(a #(a$ :  @ ;  ; 8 ;< ZQZcZ(t,Z@Z;he ph ;xh ;La ,V,V0`a `a \V; 8  l x  " " 8$ @P&L ;Pa QPaH 4Ig4IW W `TJ;\ \ ` t, ,  (X ; 8 ;H R ;a naH  PZ Z H;   ,  ;D  ;  Rd ` ;a aH  Z [ HL;   $ D|  ;\  ; X RDH d ; h ;(b (bH  P[ [ H,;     =,  ;L x ; `< h ; p RL z<|  ;pb pbH  [ \ `;    =, , ;H D ;T `\D  ; x R ;b bH h\ \ `;    =, (, T ;H  ;( `(H ` ;p p R0 ;c -cH $ ] B8] `Y;    =,, X, ;H  ; `H  ; lx R ;Hc HcH ( ] ] `d;8 8  ;T(  ; | X  | P h R   ;  ;c cH , 0^ h^ H;D D  (P D`( S g t,  ,, Xx \ ," " |' ;c cH d 0    _ _ $_ (1` 8?8` `n n ,T_8 ;d ld d ;d nd E d \a 4 4 $e   \a Wp ;`i `i0 pi ;i  j  + j : hk` J oX [ q dq ;q r ;r 8s ;\s k u ${h @x T|<    ȅ ;  ;Ď  ;   ;  8H 0 ر ; i i\ j $j 0j& ;h , h0 ?  P x f L t   ;   d@  ;  \  h`  ;   ; 0  ` ;x    ; 4   I 8L \  o l l `l  < X `  H @  ;  ; 4 L$ B pT T    ;  ; ue ut v0 \v@ v  w0 v0 Lw0 v  v|w ;    P $ 8 3 T8 J 8 ^ < m 0 0  wh     L   ; x > x \   E =E (:,E (TE (2|E (ME (bE (tE (F (DF (lF (F (2'F (F ( G (4G ("\G (5G (OG (fG (yG (;   ;  ;  ; |" " ;" - ;. H;/ ĎĎ܎;/ /h 80 P3 4 4 l7 ": : ;: 6B؏R`;= i= > vx?| ,F ;%P (Z%Q (q%,Q (%TQ (%|Q T%Q (%Q (% R (%HR ( &pR (&&R (F&R (V&R T_&4 -|@ -8B  ; L L8-MD-DMa-TM~-dMHn -Hn .`X hn J.hn iS.; 4 ;P  ; P ;p  ;  ; khX d.X \kz.; tm.0.D`.`.`.$`..$. /$/+/$:/I/$X/h/$x/{/$u/n/; P]/;  t/; /@ t/^ ^ /;' @n/;+ 0+ 0- #0. 402l L0H3 n k0n |0n \0;@A l0;DC 0DC\ 0;E 0; J 0 ,0 1;\N 1\N (1pN 91xN4 J1NH a1NT u1HOT 1O4 1OH 1P ` 1` 1` 1` n n  1; Q  1< ;HQ 2;XQ d 2;U V ;V T28 $28 02@ F24 W2 j2> ;PR `R ;dR s22(MD 2g$ 2{ 22d 2ԏD ,B 34J *3^@3b333Z$ 30 3$`3Z3< 4414E4f4h v4TH $4T 44m 4|D 40^ 84 4 J< 535]5|5(X0558 54\ 5 56TH #6F67L@, Q7T l7 7$o 7< 77 78P 70$ 7 828  F8,M d X88t 8PZ 88ؒ@ 88l  89"9?9Di _9L s99 9U 99X 9@6 ::C  /:@ <:Q:4O ^:` t:::Xx ::::;5;0 D;he S;r;;` ;;;<*<  <<ȭ E<b< q<(d < <Dn <; {  <L <Ȏ  <Hn< <"= 4=Y= f={=$x ==@g8 = =)  ===$>9>G>$ a>6 Vq>pP }>` >L >>Ip >?Z 8?tM3?W A?g???? ?\ ?\@u, @ 3@DX C@  ]@\ @\@ @h @@ @@h @A=A\A$ }Ax\hA= AAU AAHQ" AB+BEX QE h{E EH E, E@D E\E YE` (F)Fȁp :FD QF _Fl oFFF\ F6, Fx` FFG(GHG$ VGgG@A G\L G' GGS  Gh# GT HHo4 *HCHRHl` hHܟD HXQ@ HU HH̅4 H$ Hx@x IX?$ I| H>I bIII I` I] 8Iм  ID IxH TJ  JV +J, @JWJ sJ |JJE JJ J JK/K(V>K1XSKd dKK4 K( KK Ka K,4 LT LX %LGL9sWLn dLp O_vLLV (L@ LL<0 L0` L4M M &MD 3MHM8 YM/ jMMLd MMMMh ML N'N(h 8NXxNN`p hN|? }NNI4 N(  N` NHvN NOXyx O h !O=OD OOyOW OOOOO% :P P:PQP] 8bPV ({PܯT P  P[ 8P`A PHQ" PxN P_ PQ('Q; =QX RQt_QQQLr Q QhX 8Q QR4HRX>R?X NRL  [RRRP RT@ RR(MRSh\ 8$Sx ;SjS` SS ` S4 S\& SSTE .TPT4] [7@ eTTT=%L TT<X TWH U Ut( CU' TU  hUqt }U\ UyT UU, U@ UXx VTx VP &V8  8V\ NV bVsVV` VV VV W)WL @W^WH mWW| WW, W̫4 WX5x Xa =XXXvXt0 XX XE XX X Y Y, L ,YFY@ WYYY| YYY Z:Z IZ+, [Zn cZ rZU Z0 Z0 Zn aZw4 ZZ' Z  Z [ ,[J[h Z[0 i[[ [ [[Pd [fbf  rf8 fP} ff f h fg gT1 P8gIglgggHL gsT gg  h!hOhchhD h1 HhD  hhiP i:i\ Ki1 (siiip iܩ iP ijjԎ  ,j] Aj\( Yj: mj2 j jjj k8  k3 2k BkXXPXkkHski k kkkkgD l-lA Al08 Yl R2n ila {lx   lS llPn llD lm0mQmT@ dm4 wmm,8 m_ m mn)n@np Qngnx n(_4 n$ n' n n(X nT nܥ oE oU 'o8\ 4o GoToS1 ]o4 to[oP ooopa p3 ;p_ppp ppu(p; pq)q@ X*ԩ 9q^qq@  qY qD qy  q a q r  rh /rHrar qr rdx@ rr >h@ @D D` ` 0`p`B8a&HbL2v@ zL@Y08d/ oП% !z }