ELF(@q4$4 ('&p$*$*$*444  TTT0*0*++ + DW(e^^ ^ hhpppDDQtdRtd++ + 44/lib/ld-linux-armhf.so.3GNUGNU $4f>)i&,w  @,B4@ L5`TЊ$@ 2M` K\ T`@(Ex,PB,) @PFHR ((& "8@@@ (   @"XB@ AA !H \J` @ AE)Q @A% m T@@( CEHCE$ A  p&%`cB(%aB AJrA@(AHP   !"#$&'()*+,-./0123456789:;<=>?@ACDFGHIKLMOPQTVWXYZ\]^_`abdefgijklopqstuvwz{|}~    !"#$&()+,-./0123457:;=>?@ABCDEFGHIJMNORTVWXYZ[]^_`abefghijklmnopqrstuvwyz{|}NxDD'GB% 6AM|AkF멦΁gcUHWkK}dUqV p'␕{% WʸW+l] 4&yMJëGqqX}ZCY%kv: OIB}Ml|q{|i=!TÎ,m&Y7|#P82<[#%owT<L EOֺ?~|ĖsVjCA1Ar3u:? O'[;\v "RwɑFyܾ]?kƛ_%#+ƣd/ Dnˡ2u9ځhì9vN[q;BN3q/[4y!SBf~ ^%u LFww%(cZI㸏v!.LuKq#/mgr ޤ TkP7ೕx|Qi[_k^-ϱ2,|ɬe.7; R  f _v>  j] 5B  / ju RN N x<tP %<3 |  s uPQ }P (gu(?60 =L - X  #0C; h L ,U kR     ~vWotH  +v > n & a< \; |( ;4 = hp} Y^<Q H ( >-?S,ix P W[ TMZLpu G AS ){ \3 ]  $<   l[ p B y P i{tL <hE 2  a &Q R <+ eF],U0  5c   F)  <SGJ$&S S 1aDoLK  ?xD ].0 5IDTQ PC = T`2|= H    fzZ}3Z) \F >9 j  Q (R )+Pigg0 L libosmoctrl.so.0_ITM_deregisterTMCloneTableinstall_node__gmon_start__vty_out_Jv_RegisterClasses_ITM_registerTMCloneTablectrl_interface_setupctrl_parse_get_numctrl_cmd_def_makectrl_cmd_installctrl_vty_initctrl_cmd_def_sendctrl_cmd_def_is_zombielibosmoabis.so.15osmo_stream_srv_create2osmo_stream_srv_link_destroyosmo_stream_srv_set_read_cbosmo_stream_srv_link_openosmo_stream_srv_get_dataosmo_stream_srv_link_set_datavty_out_rate_ctr_grouposmo_stream_srv_link_set_addrosmo_stream_srv_link_set_nameosmo_stream_srv_link_set_accept_cbosmo_stream_srv_sendosmo_stream_srv_link_createosmo_stream_srv_link_get_dataosmo_stream_srv_destroyosmo_stream_srv_set_closed_cbe1inp_ipa_bts_rsl_close_ne1inp_line_bind_opse1inp_line_updatee1inp_signal_nameslibosmo_abis_inite1inp_line_createe1inp_signtype_namee1inp_ts_config_signe1inp_sign_link_destroye1inp_ipa_bts_rsl_connect_ne1inp_line_find_finiabis_sendmsge1inp_vty_inite1inp_sign_link_createlibosmotrau.so.11osmo_fr_check_sidosmo_hr_check_sidosmo_efr_check_sidosmo_hr_sid_resetosmo_fr_sid_classifyosmo_efr_sid_classifyosmo_rtp_socket_createosmo_csd_ra2_16k_packosmo_csd144_to_atrau_bitsosmo_rtp_send_frame_extosmo_rtp_socket_set_ptosmo_rtp_skipped_frameosmo_rtp_socket_statsosmo_csd_ra2_16k_unpackosmo_rtp_socket_pollosmo_rtp_socket_set_dscposmo_rtp_socket_freeosmo_csd_ra2_8k_packosmo_rtp_socket_set_priorityosmo_rtp_socket_log_statsosmo_rtp_socket_set_paramosmo_csd144_from_atrau_bitsosmo_rtp_socket_bindosmo_rtp_initosmo_rtp_socket_connectosmo_csd_ra2_8k_unpackosmo_rtp_set_source_descosmo_rtp_get_bound_ip_portlibosmocodec.so.4osmo_amr_type_namesosmo_fr_sid_resetosmo_ecu_destroyosmo_amr_rtp_decosmo_ecu_initosmo_ecu_frame_outosmo_hr_sid_classifyosmo_ecu_is_dtx_pauseosmo_ecu_frame_inosmo_efr_sid_resetlibortp.so.10libpthread.so.0recvfromraisesendto__errno_locationlibrt.so.1clock_gettimelibosmonetif.so.11osmux_xfrm_input_deliverosmux_xfrm_output_allocosmo_twrtp_bind_localosmo_rtp_buildosmux_xfrm_input_set_batch_factorosmo_twrtp_createosmux_xfrm_input_open_circuitosmux_xfrm_output_set_rtp_msgb_alloc_cbosmo_twjit_get_rr_infoosmux_xfrm_output_set_rtp_ssrcosmux_xfrm_input_set_nameosmo_rtp_handle_createosmux_xfrm_output_set_rtp_pl_typeosmo_twrtp_set_socket_prioosmo_stream_srv_link_set_typeosmux_xfrm_output_set_tx_cbosmo_rtp_get_hdrosmux_xfrm_input_set_deliver_cbosmo_stream_srv_link_set_msgb_alloc_infoosmo_rtp_handle_freeosmo_twrtp_get_twjitosmo_twrtp_twjit_rx_ctrlosmo_twrtp_tx_quantumosmo_stream_srv_link_set_domainosmo_twjit_config_writeosmux_xfrm_input_close_circuitosmux_xfrm_input_set_batch_sizeosmo_twrtp_get_statsosmo_twrtp_set_dscposmux_xfrm_inputosmux_xfrm_input_get_deliver_cb_dataosmo_stream_srv_link_set_tx_queue_max_lengthosmo_twjit_config_allocosmo_twrtp_set_sdesosmux_xfrm_output_schedosmo_twrtp_tx_skiposmo_twrtp_twjit_rx_pollosmux_xfrm_output_pullosmux_xfrm_input_allocosmo_twrtp_destroyosmo_twrtp_set_remoteosmo_twjit_vty_initosmo_rtp_get_payloadosmux_xfrm_input_set_initial_seqnumosmo_twjit_get_statslibosmogsm.so.20abis_mm_event_cause_namesdbm2rxlevosmo_csd_12k_6k_encode_framelapdm_phsap_dequeue_prim_fnlapdm_t200_fnosmo_tlvp_mergeabis_nm_pchan4chcombabis_nm_att_namestlv_def_patchgsm0858_rsl_ul_meas_encrsl_chan_nr_strabis_nm_att_tlvdefosmo_csd_12k_6k_decode_framegsm48_chan_mode_namesrsl_att_tlvdefabis_nm_nack_cause_nameabis_nm_ipa_magicgsm48_number_of_paging_subchannelstlv_parsersl_ipac_eie_tlvdefrsl_err_nameosmo_rlp_decodegsm_band_parselapdm_phsap_uplapdm_channel_exitlapdm_channel_set_flagsrxlev2dbmabis_nm_dump_fohosmo_gsm48_rest_octets_si3_encodeosmo_gsm48_rest_octets_si3_decodeosmo_gsm48_rest_octets_si4_encodelapdm_channel_set_t200_fnlapdm_channel_init3osmo_tlvp_copyms_pwr_dbmosmo_gsm48_rest_octets_si4_decodeosmo_bts_features_descsosmo_gsm48_si1ro_nch_pos_decodeabis_nm_put_sw_filems_pwr_ctl_lvlgsm48_rr_msg_namersl_rll_push_l3lapdm_rslms_recvmsgabis_nm_osmo_att_tlvdefabis_nm_adm_state_namesrsl_or_ipac_msg_nameabis_nm_opstate_nameabis_nm_avail_namegsm0502_calc_paging_groupgsm_fn2gsmtimegsm_gsmtime2fnrsl_msg_nameabis_nm_fail_evt_vrepgsm_band_nameabis_nm_obj_class_namesabis_nm_att_tlvdef_ipagsm_chan_t_namesrsl_act_type_namesipa_prepend_header_extabis_nm_osmo_magicgsm0808_chosen_enc_alg_namestlv_parse2lapdm_channel_set_l1lapdm_channel_set_l3gsm_fn_as_gsmtime_strosmo_dump_gsmtimeosmo_csd_3k6_encode_framersl_rll_simplegsm_arfcn2band_rcosmo_plmn_from_bcdabis_nm_chcomb4pchangsm0502_fn2ccch_blockosmo_sitype_strsrsl_ipac_msg_nameabis_nm_msgtype_namesosmo_csd_3k6_decode_frameosmo_rsl2sitypelibosmoisdn.so.0osmo_v110_decode_frameosmo_v110_encode_framelibosmovty.so.13osmo_tdef_vty_groups_initcfg_no_description_cmdvty_cmd_string_from_valstrosmo_tdef_vty_groups_writevty_ref_gen_mode_namesvty_ref_gen_mode_desclogging_vty_add_deprecated_subsysosmo_talloc_vty_add_cmdsprint_versionvty_read_config_fileosmo_cpu_sched_vty_initinstall_element_veinstall_elementosmo_stats_vty_add_cmdslogging_vty_add_cmdscfg_description_cmdosmo_fsm_vty_add_cmdsosmo_log_vty2tgttelnet_init_defaultvty_dump_xml_ref_modelibosmocore.so.22osmo_tdefs_resetlog_parse_category_maskmsgb_alloclogp_stubosmo_get_macaddrrate_ctr_initget_value_stringosmo_init_ignore_signalsosmo_stats_initgsmtap_source_add_sinkbitvec_set_bit_pososmo_fsm_registerlog_get_filter_dataosmo_wqueue_initosmo_wqueue_enqueueosmo_log_infoosmo_ubit2pbit_extosmo_crc8gen_compute_bitslog_set_log_levelmsgb_dequeueosmo_timer_pendingmsgb_hexdumposmo_fsm_state_nameosmo_sockaddr_str_from_in_addrlog_reset_contextgsmtap_source_init2bitvec_get_uint_osmo_fsm_inst_dispatchosmo_timer_setuplogp2bitvec_set_bytesosmo_fd_closerate_ctr_addosmo_init_logging2_osmo_tdef_fsm_inst_state_chgosmo_vlogpmsgb_lengthosmo_pbit2ubitmsgb_datagsmtap_send_exrate_ctr_group_alloclog_set_contextosmo_hexdump_nospcosmo_sockaddr_str_from_sockaddrget_string_valueosmo_timer_scheduleosmo_hexdumposmo_panicbitvec_set_uintmsgb_freeosmo_sockaddr_to_strget_value_string_or_nullbitvec_set_bitosmo_tdef_getosmo_fd_unregistermsgb_talloc_ctx_initbitvec_allocosmo_sockaddr_cmposmo_isqrt32osmo_stderr_targetosmo_fsm_inst_namemsgb_copyosmo_fd_setuposmo_fsm_inst_update_id_flog_set_use_colorbitvec_get_bit_pososmo_daemonizeosmo_str_tolowerlog_check_level_osmo_fsm_inst_state_chgosmo_fd_update_whenosmo_strlcpymsgb_enqueueosmo_timer_delosmo_sock_init2_ofdosmo_sockaddr_to_str_bufbitvec_freeosmo_fd_registerosmo_signal_register_handlerbitvec_unpackrate_ctr_group_resetosmo_select_mainosmo_signal_dispatchosmo_fsm_inst_freelog_set_print_timestamposmo_signal_unregister_handlerosmo_fsm_inst_alloclog_get_filterlog_set_filter_datalog_set_filtergsmtap_sendrate_ctr_group_get_ctrlog_get_contextlibdl.so.2libtalloc.so.2_talloc_memdup_talloc_set_destructortalloc_pooltalloc_strdup_talloc_zerotalloc_named_const_talloc_freetalloc_asprintftalloc_set_name_consttalloc_report_fulltalloc_enable_null_trackinglibsctp.so.1libc.so.6fflush_IO_putcfopenstrncmpinet_atonoptindperrorinet_ntoasignalputsabortgetpidinet_pton__assert_failstrtolstrlenmemsetwritevfseekmemcmpgetnameinfostdout__isoc99_fscanfstrnlenmemcpyfclosestrtoulmallocsched_setschedulergetpeernameoptargstderrreadvgetopt_longfwritefreadfprintfgetsockname__xpg_strerror_r__xstatmemmoveopterrstrcmpstrerror__libc_start_mainrandomsnprintf_edata__bss_start__bss_start____bss_end____end___end/usr/local/jenkins-build/inst-osmo-bts-oc2g/libLIBOSMOISDN_1.0TALLOC_2.0.2GLIBC_2.4LIBOSMOCTRL_1.0LIBOSMOCORE_1.0GLIBC_2.7LIBOSMOGSM_1.0            W q  " j ii   @q:f q#&3 ii  0ii 6ii  #  @e <+  <3 4\3 \; $< = |= `= XE \F ttH tP 3P P TQ VQ Q zR ~S .S /[ [ P Fx  d ; f     ` ` ` ` ` m ` D$` J(` ,` &0` 4` r8` <` [@` D` H` L` P` MT` X` O\` R`` d` ?h` l` @p` at` x` |` `  ` w` j` H` ` ` ` ` Y` @` ` ` ,` K` b` ` ` ` ` x` T` ` e` ` ` ` G` ` ` ` 8` Ta Xa Ka 7 a 'a )a a a  a C$a *(a O,a =0a 4a 8a Whb lb \pb xtb yxb n|b gb |b Ib $b b 4b %b Hb 0b 7b b kb &b >b ub +b db b b qb b lb Db b b -b b Eb =b (b b $b {c c c ^ c "c c c <c  c $c h(c ,c 0c 4c Z8c s@D3   0@@2Am8P2`@ 0@ MU PU P 0@% 0@# 0 @[0u`V P0@ 4   0@[@80@(4   0@^@80@( # @ @^0 BAmP` MU> U U UA AQH|88ll~ PU# P p  @@@2* Ol4 nD &bf V&V@@UTpЍ@` Ѝ PP R #  p  @@@27oEQl8pppU 2 0@@To LP  # P@@ @2@EQ2$$$$$2 0@`VP #P @ # @@ @3! R  R PP2 0@@T4 P @ # @ @2@P2 0@@T+ P @ # @ @2@P4  P@0@ W@5  P@0@ M4  P@0@ C4  P@0@ 92 0@ R P  0@# 0 @3B #4  `0@@0AmP `MR3 B` @@0S_ P X p@@\ 0@# 0 @V> W1r3 40@  Cs3 \0@  ;(B` @@0S< NPQV9 @T? DP @e| 0@# 0 @f5 @JЍ@`ЁЍX p@@E\5  0@V@2p@D( @@*|5   0@f@p@xBm@P` Mu :1S  l2 0@`PU:V PRr400S@#L@p7s` @PM@T V P@PP M@0 孏T0 s{O W VL P.400S Ѝ@`Ёء Ѝ 5r 0@ # @ @ 5 % p  @@@0 @ 0@# 0 @5%  p  @@@0@z5   0@@h@m5   0@ @[b@mPC  M@@?H 40I \0 Ѝ@Ѝ- M00 Ѝ- M00 Ѝ -@MaP #80< @Pڶ3 < 03ЍDD B0C$ @Bm`pP DM00, :1S0 P`lU @[<0 , 0C,00 (00 $@S RR00R0SX0 SS00O,1.D80 +41ᜳc1,^^ 0 @R (  0 0$ S k <  B2 0@Z  P P 2 0@@T ~P$P  0DЍ@`Ёء Ѝ 0 @s ! $>PY O<4,>D;8"2ᑳc&S S2S1^4  ( 0RR00R00S? R 0 @S1 0 S1 PP"14800r Q  @Q R 800 R p0 @40?40S:48UO, .D +48#1ᜳcS1I48D$w$0 `@7 0@#  @u? ed$,0FP $0:<044 00,0RQ` $ 6P :4$ R d$/ Q <  BR%% p  @@@0N%  p  @@@0F$0 ` ( O(  0@01#  @$0 `97  0@u @ $0 ` , *(o(7 , 0@ @ 4 R= RW 4 B ,0$0R 3 < L00 ,0R   R   R     4(0<0 8d$04848~ 4 &  p  @@@0!48 m!48 g48bO<!>D8 +4 #1ᒳc 4 S1048Q48M2 0@PU& P $0 `P  @0# 0 @c?"@ai#  p  @@@1m$0 `pw6   0@cp@ @2 0@ R P  # P@ @W1-6  0@@WBm@P0`p |M0CSB `L`  @[ Pi0  R ' R    P @T UP o@l|Ѝ@`Ёء Ѝ$0S T`Rh2 0@!,0 0@ 0 @  c ! $kP 0S% #+R9 0C,@ 0 0<0$0 P @$0S~ T`P0 0P0(1VPLĠ 0 NL% `   L@$0S^  倂Tp @Rh2 0@!,0 0@ ]`V P00CS`VU Pu nX 0@# 0 @4 :d$0S' T`Rh2 0@!,0 0@ (0 @  c ! $pP42 0@`V) P _@<%  p  @@@0*`p @ t # @ @ 3` 4 PP R 0LЀS@_2 0@ R{ TP' 0 C j 0C0H $ 0zjpjz:0z'z'z:1131zzgz:1#80<$AQ3 %<  ?8   @#  @4(2z  1z  /z  *3+S,@ @0 0<0 9  0@ 2z  1z  /z @  P X0L`1z/j2z, zx*F# *Cr :z1z{ 0؃s0#{z3800P 00 C SRD0S <SC!0 r 0CSࠃh @1t3+S!,0@@p,<p@DP@P #TLP X&#\`&$& !!00O@' X9  0@ @pp @ t8  0@p @v@@Fh  @\\`@ 0@ 0 SgfF %AA#LaR!  L8p @J$%1 @#  @00z3 z  z8    '0D0Ep @, # @ @3 kh| @~ @#@L< np @8$%8 0@< (z8  z  z  @  dKH 0@# 0 @3,T<p @,8  0@@0 %H8   0@@2@D$ 0CD B@  @ @-@MP #80<L\ ڶ#7<03Ѝ@ЍGD$ D B@0C@Bm@ 0` 4M0q0 4 S  S S 2 0@ Rd 4P@M4Ѝ@`Ёء Ѝ 2@P :,01SY O,p.D( $ lP(0* RR #1ᒣcS10L10 0 0 W`b Pg  \ $00 0 < N PH0 R,   局  VPP. ]A0P$0k ,0 p1S%  p  @@@0T 0 000 %Q (![ *j     r /&PP @^PY :!R 0AS8أأأ 0@# 0 @2@@ <;0S@@2l`00PS00S5@&%0S? Sg @TE ;2 0@ R} DP  0@# 0 @j2@% p  @@@0 : L' Z0L70S 0S 0@L7@&  p  @@@02 0@@T! P `@ 7 0@#  @'2 p h@*P7S @a@`P 7  0@' P@9  0@@9  0@@j@Am``pMQ 2@ 0@PUS P<P@U.@T+ 80S0 0R40P,<  z0@@DTwPP-?(b A%EScPt>  0@@u/Z2 0@ R  P \ 0@# 0 @7=  @0@u\>  0@@ @-@B@Ѝ0P /AmP@`|4`  p@@`@ pw0U@ @`ЍP@m@4M 0P B 0  0@{4Ѝ@ЍAmR@ P@ ``MR P:QL q:!Q$ AQQPp0Pj頼 PPPP%$00p 0]} 0Qv 0 00 000Ѝ@`Ѝ @0 `@0@\  @03 Q0 S0000@T3 0P^ \ `@ @Od 0@\ 0 @4 ^0 S00000 @0 `@\ 0@@@n`P\  @"d0  \ 0@@P^0 0Q 0  0Qv 0@ 0Qm 0j 0 !rAmBP @@`p`MXJ P%0S7 P z 0@\ 0 @4  (=zzzgzЍ@`ЁЍT 0@\ 0 @4 0Sz0 \ 0@@  gT,0  \ 0@@zD0Am@`MPU 2` 0@pW$ RP @eЍ@`Ѝ@d 0@\ 0 @U?@S0 \  0@U@A Am> `0@P$M R! $`^2 0@pW7  P㲃$Ѝ@`Ѝ@,!#<`P-8!2@ 0@@ P (  @@  @  \  @7[@,!#<`Px-81@@ @ P@(1  0@   @ @ \ @\  p  @@@7H@m@MQ(   8   0      00Ѝ@Ѝ 0 0 0 2P 0@ R sP  0@\ 0 @"02 \ P0@@{@-P@MT 0 (PЍ@Ѝ#2 0@ R DP P \ @@ @3KP1 \ 0@@M Am> `0@P M R! $` 2 0@ R# PցЍ@` Ѝ0| #<@`\  @t7\  p  @@@r7@|1 #L\ `0@@t AmAB`P @@MQ'XXXDXXXXXXXXXX0S P 0 \ @0 @4;0Su P 0@\ 0 @4(Ѝ@`Ѝ0S P 0 \ @0 @40S P 0 \ @0 @40Sg wP 0 \ @0 @40S fP 0 \ @0 @40Sc UP1 \p `@p@ P0S GP`U0S0\ 0@@ Ѝ@`ЍO4 0 ? 0 @\ 0 @4@ 1 \ 0@@ &O1 \ 0@@ E1 \ 0@@ ;1 \ 0@@ 1 \ 0@@ %1 \ 0@@ BmP`` $M0ST *pPW  F@2 0@pW P1$Ѝ@`Ёء Ѝ  l@0 Ƞ <4> "0@ @180Z 0K P, 0$Ѝ@`Ёء $ЍgO+P%+ \ P@ @? % p  @@@0%  p  @@@0<++P @~@ 0@\ 0 @2 P<" **P @c @2  \ 0@@ PN*@*1  @\ 0@@?k00CS ////\ R 01P  01P Q/ /P@-  1S l0@Ѝ % p  @@@0x%  p  @@@0pAm@P` MC :1SG lP` 0 8 <2 0@ R% P !  @0PЍ@` Ѝ l 0@\ 0 @1Ѝ@` Ѝ l2 \ 0@@% p  @@@0%  p  @@@0P- M  1S l0M S  Ѝ% p  @@@0%  p  @@@0R 0A P SR 00  00( 10S S 2@mP 0@@MT 0PЍ@Ѝ / /`| @@\  @@ =`|2 \ @0@ , 0 S0 S/ 3C 0S /BmhP@` $MQ񟗸$tP00S :1S lb0 `@ 0p 0 Ƞ<0p 0 P00 U40 8<0j P0S P @ 0@\ 0 @/6'  @0x$Ѝ@`Ёء Ѝ00S :1S ln0p` 0P 0 Ƞ<0P  [ F`0 408 <00Rhhh00S< :1S@ lp'0 0` 0 Ƞ<0}`00  0 4 0 8<0$PI> "0@ @1hPYP Pu% &%! @0f,< 0@ @< @  pp kN,< 0@ @H @ 00S :!R > 0@l1 `RJ|P(pQ `FCvPEp Q(0`V :1S l0 0p 0 Ƞ<00p   ~ 0 00 4 0 8<0P0S b `@PUl pP0Ss hP v!   @0ANP :8 00H3L0b `@Z JP X0S ?P, @02 0@ R -PV,< @ 0@ @ o0S  2 0@ R= PO Gp% p  @@@0%  p  @@@000 0`T 0@\ 0 @6g`)  ;P  @@ 0@\ 0 @2Kp`@@t 0@\ 0 @-6 9@ 0@\ 0 @O4(fp`@@ 0@\ 0 @L4 @G`@P 0@\ 0 @5 Pu @' @@\  @[5 Pp`@ @ 0@\ 0 @W5 3 \ 0@@j `@p@ot3  \ 0@-@@\@a; \ 0@ O@O`p@@R2 \ 0@L@@>`@C2 \ 0@@P/ 0Sp0 0s`@p @(2  \ 0@W@@3 \ 0@@ [eMPl :80h@; \ 0@ /@9`T3 \ 0@@5&AmhP` lUP0 @` Ѝ@h0U P 0AmP# @ @`` '0  @` P@`Ѝ 0AmP# @ @`` 0 0  @` P@`Ѝ  0p\p / 0\0# Am @@P` 0 `  P@Ѝ 0@m0MS" :1S& Q@P*h h0R Ѝ@Ѝ0Sw o0SA $0JS0L7% p  @@@0%  p  @@@02 0@ R  P ` 0@\ 0 @e4 P@hP% 5`3 \ 0@@ePQ{0Am@P``#  @R0 `` P@Ѝ 0# @- @@=0 @Ѝ AmP,`h`< @ 0@@MpW h0 7/  @JU h0U#h0U P Ѝ@`Ѝ2 0@0S3 $ `h0@ @UPP,4 \ "0@@ 2 0@0S iP `3  h`0@@, @\  @UPP3 PS `P@Bm@` 4MqpQXWppkQYh9.  @` 8##$0 ^ R P@ R (P0S  P p W\R P   9@p#0 0  > 0@) $0hp=(0`W 0\ R P , ``P@\  @[3 @P U 2 0@ R P 4Ѝ@`Ёء ЍR P  p@0 @p(0(0 @\  @I3  @ 0@\ 0 @ =k`0p@(0(0 \ @ @0>3 0SQ@; \ 0@ @I Qv Rs  Rx XP 0 `\ @0 @S3`pp( @j4 >( \ 0@p@Wp@\ \ @ @p?   0\ ,5 `@@ 0@[P8Rp, @<( @p6( 4 I0@\ @, " p( @%4 ( 0@\ @ 0X \ @0 @93X4 \ 0@@9`4 \ 0@@SBm@` MqPQxWUPP+Q[(9.  @ 7##0  b `@ R P0S S. 9 @L+#0 Rb<\2 0@ R PЍ@`Ёء Ѝ0S P. 9 @L {+  ?0S qP. 9 @L {+  -0S _P. 9 @L {+  0Sh MP 0@\ 0 @50SK 9P0h =(0 Rh v0S &P 0@\ 0 @+5$( [}`0030 \ @ @ 05 L`P !0  \ 0@P@=5 \ 0@@ 0\ 0@@ l5 \ 0@@ UX5 \ 0@@ Qq5 \ 0@@ W Rc P+ 0 `\ @0 @#560X \ @0 @40\ 0@@ + X4 \ 0@@> )0@L  @5!\  @PPLX 0@\ 0 @Q> 0@\ 0 @5l 0@\ 0 @5`5 \ 0@@#uꨞBm@` 4MqQxWXoQ4`S$0i9.  @7##(0 ` R P@Z /P0S 'P Z_X P  $9@p# #00 >  0@$0s'pp(0hp=(0`W 0\ R P , ``P@\  @6 @P Z 2 0@ R P 4Ѝ@`Ёء ЍZ P p@ @0 0@\ 0 @< $@ 0@\ 0 @5ip`@ \ @5 @ 0SQ@; \ 0@ @I Qx Ru  Rt _P 0\ `\ @0 @ 6`p@r5 \ 0@@_p@d \ @ @5  0\ ,5 `@@ 0@PBWp@G  @, @, 06 0@\ @ ,p@/6  0@\ @0X \ @0 @_>X4 \ 0@@_ `\6 \ 0@@  0 40 8 /q0Q(RS00 QQ > 0@!!#//0Bm0` MSg :1Sk pl@h h0R 2 0@ RL P2:P7S> > 0@1X |@(0ī `@0@ U[d R `@V U HLP PЍ@`Ёء Ѝ` 0@\ 0 @4:P7S `6 \ 0@@p% p  @@@0%  p  @@@0Am@QP` M 0S Ѝ@` Ѝh h0R`Vo g:'RGZ2 0@ R P ` 0@\ 0 @96Ih! ?`6 \ 0@@9Am@P`pM`EV, 2 0@Yh PD0S S5 @\A\0  0@㜀(Ѝ@`ЁЍG\0 40@ 0S2 SL0PSUN  NϠ@\\0 㑅(0@\ Hp  @@@!1.8@p@ 0@\ 0 @1 J\0 4 0@X8@p@6 p\ 0@@\ Hp  @@@:1cB2` 0@ R NP0P(9B PV :WyP \ P@ @.17 \ 0@@.HAm@P`M` :1Su Rpl P@`XD P&Q PUj  PLl @^$0Q 0&  0 LЍ@`ЁЍ@0 0@\ 0 @i1^Q '  @W@07 \ i 0@@Q % p  @@@0U@P 0@\ 0 @n1-%  p  @@@0<@P7 \  0@n@0.  @0 ! <AmP` -@r@ 00&  @0@` ЍU0S R@-@Ѝ/Q@- R @Ѝ @Ѝ @ЍQ@- _@Ѝ/AmP` U @ L F@` Ѝ@-@b0#  @0  G@Ѝ@-A@Ѝ/ DR /S@-@M :1S l0 0SЍ@Ѝ}0 0:% p  @@@0t%  p  @@@0lBm@`0(MSp QS^R j1S l,0$Su l1Sr rP p@n  08 <0P (!* 000DP00i zz jRzz Ph$  @0(Ѝ@`Ё ЍXS 0CS (Ѝ@`Ё Ѝ5$ \0  0@@(Ѝ@`ЁЍQ Q0 00& @(Ѝ@`Ё Ѝl4PUT 8P 0 0@\ 0 @1x 1y 1u zzz p@\  @=  z   P% p  @@@0%  p  @@@0 7 \ 0@@ z  b0W7 \  0@@,zDP 0^#@m@P MR 2 0@ R6 PЍ@ЍS S7P 0(0Ѝ@ Ѝr#)  0@\ 0 @7 0Ѝ@ Ѝ# 7 \ 0@@@-@Ѝ:P7S: 2@-@ 0@ MR(  oP R dP  Ѝ@Ѝ` 0@\  @0 77 R0 0`8 \ 0@@7^/0@-MS 'Ѝ@Ѝ2@ 0@ R )P `@ 0@\ 0 @u>`@8 \ 0@@u/0S /@-@@ЍP@-  1S @Ѝl% p  @@@0%  p  @@@0-P M  1S z lz ЍH% p  @@@0i%  p  @@@0azDAm@` M0S3 :!R7 2l`P 0@ R8 P 0 0 Ƞ<4|,  @0Ѝ@` Ѝw<”h8 0@\  @ 7 % p  @@@0%  p  @@@0<”h8 \ 0@@( @-@ @P@Ѝ@Ѝ q0 X /0 X `/Am@P` hP  @h@` Ѝ@-@@Pdĥ@Ѝ@-@@\00\0@Ѝ@-@@\00\0@Ѝ@-@ a 0X0`@Ѝ@-@ R@ЍAmP @` `MB@0@ *@ >@> @ 0T 0{Ѝ@` ЍAm P`p ` / @@@> 0@ N`4$@ @ЍAm P`p ` / @@o@> 0@N*`4$@@ЍAm` @ MP` ?P 0@K@0@ Ѝ@` ЍAm P`p ` /@ @&@> )0@ @4$#L@NP +@`Ѝo@-@  <0P d@H 8 @ 0@ @^ 0@ЍAm ``@MYP T@,P@ PJ  lP@ @@ ^@q A!1pp@@  @{1@T 0( 0@ @@\ iЍ@`Ѝ4 ] 8 @ 0@ @^ 0P 8 @ 0@ @^ 0BAm P@`  ᦕP lP@ox@` ЍAm P@`  ሕP lP@QZ@` ЍBm `PM? 0@/?P:  Q8 `8 `@0@lB8 @@, R$   @@@p R 0 T @@@^T 0S   0Ѝ@`ЁЍ%  p  @@@0@- Y? 0@>P  1S l@Ѝ% p  @@@0%  p  @@@0@- 2? 0@>P  1S l@Ѝ% p  @@@0a%  p  @@@0Y/AmP``@ 1V 8 @l 0@@`@^ Ѝ 0D@` Ѝ/BmP@`p` @@p@ T \0@ 0 @S00 TX0S! 0( 0@  @@\  h R 8 @ 0@@^ 0dQ@`ЁЍ 8 @ ` 0@@^ 0@l 8 @ @0@ Ё@`^ 0 ЍBm0 + ` @ET @ M@@r  @@0 0Pp@]a@`@(+ 0 @Q`+  0  @H+ (0 @?+ 0 0  @6P+ P0 @-+ X 0  @$, x0 @(FZn|yH& @u & @q'n#'kP%hx%e%b %_%\-%Y%V Ѝ@`Ёء ЍBmH P`p @@`M H 0DC00 pHD^`N n0Aɑ0 Y3 1:1\AWЍ@`ЁЍ临BmBP @@``p $MPXT <P!Xg AX= X R4 ,PI$Ѝ@`Ёء Ѝ0S H0S005 RL P@T  P @`P % @ @1P {ZJ$ 喿PPP 44QH((H(h(((((((((((((($0H 0H0S 000%1SH0Sx`H 0@% 0 @> -n0J 08c$c400s0 0 S 00000%1S"s H"Pm $᰾f`0H0e5  0@ @-`d 0@% 0 @>I0`PH5  0@ @Pj!H 5 0@ 0 %  @*0H 0Y 0 0 $a0S 00H 0L0P00 0 Rf  P 4@ @@%  @u?P`d5  @0@IH|P* $#00S( :1S, l01S F000%1S IHH5 0@ @0  000% p  @@@0J%  p  @@@0B@5  @0@ut0BmPS`p 4M  0@S} 0 S ^^qp> )0@I 7"#< 0 00Se $`@XH2 0@pW gP `p % @ @1p @  @P # 0#jz0  à|zzz z'z'zzzzgzz4Ѝ@`Ёء Ѝ%0 0Hs0 $00B 0 SEl/.l/\.1d11/x0--q. 9 @ 'p0S 2 0@@T P ``P``@@d7 0@% H @n2 P@c. 9 @ 'p0S2 0@p 0Wx PA `po$, 0@% 0 @22 ;/. 9 @ 'p00CS. 9 @ 'p0S  @pP $0<S@0<0@0 2 0@ 0Ry P 0pW Pq  @pP # 0#. 9 @ 'p0Sf 0Sn3.20`5`5`5`50@F> 0@# 'p0SN2 : @ Y DP `p$6 0@%  @ =. 9 @ 'p0S#2 0@pW Pn  @HkpPx 80#AQ<@3 (<  ඃ$0 R#2*4:420}. 9 @ '#000CS2 0@ 0X PC. 9 @ '#0M2 0@Y Pa ` ( p`@`p(  0@0?%  @p6Hq+`T5   0@@J  @pP #80<@@P<@ڶ3 &< 03 0  0  0 0!0!0zj_0 (  @pPq 80<@ @ P< @ڶ&0F<!0  S 002 : @ Y  9P `p$d6 0@%  @92` , `0p`@(0A( 6 ,  0@@ , `p`@+( 0@% 0 @_2 pzw2 0@ 0j``@(7   0@_@`$ 7 0@ 0 %  @TH #80L \ 0#0< #S :1S l01S&0  0005`pS$ 0@% 0 @? ~`A$ 0@% 0 @"2  $ DD B0C@!DD N$ DD B$ `$5  0@ @F`p $6 0@p @s`$,6  0@ 2@e`p``P`@ed7  p  0@@n`PP`p$d6 0@p 9@A`$5  0@ "@35&$7 0@ @&% p  @@@0$D$ s%  p  @@@00AmPS`` &0$M 0@Sc 0 Sq @TT@@ 01I I@I ##L@@000S\ 2` 0@pXD P*  @ P # 0#zEj0   à|z'z'zzzzgzz6$Ѝ@`ЁЍ`6 0@% 0 @~2 p1I`!7   0@~@1I @FAm``pMKPP 0@!S AS S PoЍ@`ЁЍ0S 00 60P0PY00 R00ᘹP 0 00 ͹PAmQ`1000 M M@@00D80P '  @P_*`P D ڍЍ@` ЍAmP U` H `@@B@ PP UP@` ЍAmP@` p{MMWE ,(`0 0'pPd 8 0@ $(1,0 0 S   0 P0S `F% P5%5 P< {ލЍ@`Ѝ'(`00 P0F N7S8O?S/noHS (  @! R qr/S2 0@ R, SP  0@0) 0 @/1@ p2 0@ R 8P @ 0) @ @pU1 8 0 0@@/p;@9 0 0@@U1@-@M@ @"P 2 0@ R P Ѝ@Ѝ| 0) @@ @0r|9 0 0@@-M0  @0"dP 2 0@ R P Ѝ 0@0) 0 @0H Ѝ9 0 0@@AmP`0`) M @MPs:0@P@Pq Q2 ,  P0   X0 x p@10SP P0 10S0S2HڍЍ@`ЁЍ'0 PR x USr_qR n X0 x p@10S PP`0 10S_^*  |@%r  PpU2 0@ R &P 0@@0)  @ 09 0 0@@+Am@`p @4M  D`VPr$0h`xPV`VapV V ( @0`4Ѝ@`ЁЍ 8 0@z14zzwz(P 2 0@ Rl P\aV1 !S=S8 l `@X  (`P012 0@ RO P ( * @- @(: )0@\*`+,  0) 0 @ ` 1S2 0@ R= kP \ 0@0) 0 @04 0) `@ @04: 0 0@@i(:  (0@@)+`P*,-: 0@0 `@Nu\: 0 0@@Gn޾PAm`Mh  1Sl Rl@` P@ $0Rhp< P (   @@: W 0@ ’0@0)  @ 01}P0 RD P#Ѝ@`Ѝ  @Ѝ@`Ѝ  : @0@W @ : 0 0@@ 0@0) 0 @n?=% p  @@@0L%  p  @@@0D; 0 0@@n@-@MP 8 0@Ѝ@Ѝ2 0@ R PЍ@Ѝ( 0@0) 0 @1(; 0 0@@AmB @@``PpU  P 0`*00@`Ѝl `@, 0 @@ZPPP\ `@AmR P@``@pT  P0 @`Ѝ, 0 @@1@P@\ @p@`Ѝl @g@-B @@L P L L<P 00@Ѝ H5F3ER-qML,MH5F3E L 0kL<PqݍЍ@- P@ЍAm@` qMM PF H5F3ERC00CSA BtP70 S:O? 0# !0r0P\ 0s0R' %0 B& $`SPSpSS3P Q Qp`0 qݍЍ@`ЍAm@` qMM &PS H5F3ER  0 ;PD0 RB   0 0CO ` % ?P !&"@#$@% & 0# 0q0 R\0 B0PqݍЍ@` Ѝ@-L@qM M L<P1 H5F3ER.00CS,( I P"2 S% ?O,$ 0# !0r0P\"0s0R003 S00 qݍЍ@Ѝ@m@qM M {P< H5F3ER  0 9;P-0 R+ "i0 ,P?O4, 0 3 0#,0q0 RP0( I2 PqݍЍ@ЍAmB @@0` MS R R Ѝ@` ЍP WVVUPpUXU@USO=3 0+>c P`PVDOO/  "$ ~ PV r Pz  PR zzgz*Rj* fzzzgQzT R zzgzzq t \ zzgz00000>2 0voC>1 0o00 |nO=3 ,0+Bc Pf`PUDOO/  "$ ~ PU r PQTz  PR zzgz*RFj* fzzzgQzT R zzgz5zq t \ zzgz   002>2 0vo=1 0'n00 |yoz0S=;BmP@` qMMp -P H5F3ER  0L L<P0SU񟗲ZXZdZ]oP1,'0 0jZjɠ0O Q zzfzFz%zGz  P㰰¡ p±¡S QzzjjzFz&zGz: S9ࣼ:š) s/O0:oZjjR/OqzzfzFz%zGz: S s0PUZqjjɠ AO zzfzFz%zGz: S s0T`O\?  0# 0q0 R\0E  0PXqݍЍ@`Ёء ЍO]>c,P3,+Bf4Pn*|y` \o2,vZBDAmB @@`M\ 0S S Ѝ@`ЍP#]x]X]8]P][[`[Q ̌+rbQ ΌvoQjΌ!͌ n0Q`PUDOO? 0#$0p0QU0s0Q0Uuj5 @ 0开`fz4A᷀` 00@zzgzzzgz0Szzgzz0 0^zzgz00000}Q|!Όό EoQ ̌.+vbQ ΌvoQq kΌioQ|όό Fo0Q_`PUDOO? 0#$0p0QU0s0Qg0Uuej5@0封afz4A᷀` 00@zzgzzzgz 0SzzgzBz00^zzgz00 00 00 00 { \Ό ioC͌  vof͌ $+vbC͌ voe͌ 8+rb;AmP ``qMM@ P H5F3ER  0L L<P0SUbb ct`V lrr.`#+vR0 0zzjj55 50z!%10  05  Fz޼0 &zG z: S9ࣶ1ơ) s/O01zzjjzFz&zGz: S9ࣸ1ơ) s/O01Zjjɠ OzzfzFz%zGz: S s0RuZjjO zzfzFz%zGz: S s0RpO\?  0# 0q0 R\0F  0+UV- oE |F_eV+ kn~`!i_\V n`"v_SqݍЍ@`ЁЍfmrr$` #+vRDCm ` "v_=3nE |F_7n~` !i_0DBm@P0 , `@@p M_`PV 0P0HU"ڄ㜜 㘼 P @@@ ' *  @U  0P0DW@UW2 0@Ѝ@`Ёء Ѝ @n k0| @0ZѾ@X0l @0Nž0\ @0FAmB @@` P PPt`P@ ЍP> 0@/@mP@ M:i?SJ1S- l 0! 0CS.  @1 Ѝ@ЍMP  0R, S S SR RJ!R l !%  p  @@@0(R R RJ1S l01 J1S l01  BR> 0@!P @0Sx Am@` 儽PPB @@`V00@` Ѝ/AmP T` cx @a@P پP@@ֿ@` Ѝ P ~70/@m@ MPP= T9@D T3,iHiXihixiiiiii$00 Ѝ@Ѝ P"0000000000002020Am@`` MdPP! T1@D T+\jjjjjjjjj8j$`tЍ@` Ѝ P `P `````bbAmP`@` $P UU UyP@1 ᦾ@` ЍAm@`P` P TT T@y R !@@` Ѝ@ @@AmP` M`P( g@  ӽP  @x0P 0  000Ѝ@` Ѝ @ @I@-@P20@Ѝ@-@P$00@Ѝ3P P 8PQ ,0 Q0@ @/P 3P D @/?P @/ @/ @Am@`MiPP aP   p @`gpk`oswexsЍ@`Ѝ/@-ͼ@ЍAm@`Pp`巾P4 @ؽḼ᳼@`ЍAm@`Pp`图P0S 0 0@0᜼ᗼ@`Ѝ0 0@ 0Am@`P` {P0 0@0z@` Ѝ2Bm@ 0@`P`p ,MXF EP%WP@a @Z 0 @hHC,Ѝ@`Ёء Ѝ@? @8 0@ 0 @C0 ㅽ @$ " @$ = C0@ @   0Am`S/ :1S3 l@``pP 0 0`0Z0l. @ 00H@/0 @@@`Ѝ% p  @@@0C%  p  @@@0;/ 0Am`S :1S! lp@P` 0˺.0 @P[@`Ѝ% p  @@@0 %  p  @@@0 0Am`S :1S l`@pP 0 ᗺ/0 @@`Ѝ!% p  @@@0ؼ%  p  @@@0м 0Am`S% :1S) l@`p Pt 0 ^ 0. @ @`Ѝ% p  @@@0㛼%  p  @@@0㓼AmH @@` 尻P㬻@` Ѝ0@mMSB @<  B}PPUP 2 0@ RF ͽPPЍ@Ѝ2 0@@T* 㽽P ۽ 0@! 0 @0/ 0@! 0 @0"P!& | p  @@@00뵽ɹ1   0@@㧻1  P0@@P㝻Bm@``T DMb TNpVp @@P( ỺP < @<@8 @T  B  IPx;[c 80#<L ^@B 3<X03C X'2 0@ R -P|  `2@@ 㐺2 0@ R| P_41   0@@@ ~w$p H@[k #80<L ^D$ D B0C@去%2   0@@@Q@TDЍ@`Ёء Ѝ<@t2 0@@T ̼P  0@! 0 @0> 0@! 0 @02 0@! 0 @0&v1  @0@@㸺T 1  0@@㭺cHBmP`@(M4.(Ѝ@`ЁЍP  $0U \    <Q 0@0 R 0\& | p  @@@0403/,03/ P$0pU7 `@ @0V`  B H W$0S  κ041 BmP0@`pA( M4`P5<7pPJ0@  T+ `PO8@`P8 @ @+%; @0@  pP`P`8Ѝ@`Ёء Ѝ2 0@@TO ϻP 0 0@! 0 @1"A2 0@Y 㵻PPJq\S p\M0\0H00շX2 P 0@@@㱹곻ǷX 0@! 0 @1" @ꢻ嶷02   0@@㓹`Am`pQAT`P@`୹\\p娹p@`Ѝp @{|  @wAmL4 0@@T$  @P`a M@ @V0 @Ѝ@` ЍBm@`QMO Q) RP@p RL4 0@ ^@ P:pp @5`p @0$ 0 @ @P p`ƺL4 "a0@ @Pp @V p@@`$ p  @0P @@媺 @Ѝ@`ЁЍ R0P@p @ L4 0@^ pP`l @@p t$ 0 @` P @|^pP `ҷl @@` $ 0 @P  @@ @ @_^@ Pp峷`p @㮷t$ 0 @p @P `E> @mR0@#A!<$0\ rt((ԄԄԄԄԄԄԄԄ   \\\\\8\\\\X  > 0@ 0SN  \ \w @Ѝ> 0@ 0S9 APQwR ,A@. w\ \N ,Q@@  AQP  w ,@ A QPw ,@ w Q w0S S 0/0 00/0S S p#  @0h/ p3 0@0h/ P/0S S CP/ 0 P/0S S Co/  @o/ 0S@oC0SA0S00 R000D0/@0D0/B0D0/AmPwO`skyo@T 00@ B D 0`0A0C0@Ѝ@m@0MSe4(ćЇLć Ѝ@Ѝo01(RPP  )  !P M +U.A0101(R9 R  R3 8S4 51@ 0r c410!0 1P  0 1P 1. 3#e011^P >@ M' Hp  @@@0㘷f &]P01 @m01M@2P 0@ R PЍ@Ѝ ' @@ @0!W7  P@0@ @m01M@  P 2P 0@ R 㱸PЍ@Ѝ^ ' @@ @0!!7  P@0@㲶01/AmZf<`$M$Ѝ@`Ѝ>@`!`!ޢP lV2 0@ R=  mP H ' `@ @0 0 ,20Y ⚵<S 2 0@ R  LP | 0@' 0 @ 0¶0 ,00|8  0@@PH8  0@@I 0dS  /0rSP01/AmZ~<`$M$Ѝ@`ЁЍ7@dS p `- >؀0!!`PBX2 0@ Rf  P H ' @ @C? f0 ,20o Ʒ7rSp`g`Vpfڀ2 0@ R.  ŷP  0@' 0 @ A?;<S 2 0@ R  㬷P | 0@' 0 @ 1"0 ,008  0@@A㰵|8  0@@㩵H8  0@@C㢵 @- @ҴP # 0#@ЍAmP` @D M咴` @@) 0 @P`)Ѝ@` ЍAm`QM8@0 CR1ڶ#^C@ #   C C C^/ <  B CЍ@`Ѝ8@ 0B S'ڶ0B 0@ p`@P@ 0pB ` P@0B#P<@D0 0L@D BL @娵&  p  @@@0㠵#PAm8@@P`M 0ESPڶ`E0`@` E  E 0 E0E(0 0@QPp2E 0@(!p W ֶPЍ@`Ѝrዶ` U @9 0@\ H @0 <w` U @س9  `\ 0@@Ŵ#D0`QX>PU] 㨱Pv e 0@\ 0 @3g @BiqbcPUW ㈱PV E. Pd @ @㒛)\ D4P @ ?.0; \  0@@クw :M-bP [Fx< \  0@@k < \  0@@` 0@\ 0 @3㷯 d@<  0@㑛)D \ @>߰< \  0@@3԰; \  0@@(n` BmP@`bp `@MMX Pi \w <0 0C0C P,奯d @>70, @P ,@1,S - R 00X0 㿰PZ(1T D0S Q @T{ 㭰P9#{ލЍ@`ЁЍ0?s X:1p*\0 4 0@PtP_J= 0@\  @0F> \&  p  @@@0 0 0@\ 0 @4! \ @ @= ֮4= 0@/= \  0@F@[Gt @jq= \  0@@G}= 0@ @T# P گ 0@\ 0 @4 叮_ǯ=  0@\ @>ữ> \  0@@` Am@< P@` 00@` Ѝ @-@@ ,0P <@ @<Ѝ@@Ѝ s+@m0@@ M 0R A RN꼮x<0 Qʀ *1l;4|>04  0(Ѝ@Ѝ)@T Q0  0$!R001 0!1S  ʃ!l+ 0!l+1S  ! 0!2P 0@@T \P 0 @L 0@\ 0 @5 ͭ 0PL>  P\ 0@@Y 0BmB0 @@`Pp` MMY &PU \c <0  0C0C⮮P0S& 寮P0W @T~ P î 0@\ 0 @$5yލЍ@`Ёء Ѝ0SY @T ߮P ᜮ 0@\ 0 @F5R፮t> 0@\  @05C \&  p  @@@0O R1 Q. Q+ \( L^e \b\w@T  㛮P3 X` 0@\ 0 @45$I> \  0@$@㝬@T/ yP 6 0@\ 0 @*5 5m t> \ 0@@t1> 0@/ X >  0@*P\ @]@T 9P 4 0@\ 0 @/5㬬 0S  P ݭ 0@\ 0 @75㓬H0 0JJ I 0 SS$ Ἥ? \  0@F@0屬 @J  C 00 pP[< 0@㋪00S (R$2Sv ". Rr 0 @0A 0S 0@ 0R _P @T# 㷭P t 0@@\ 0 @t5  % @MnY4? \  0@/@㭫)N`? \  0@4@㢫@T ~P ; \ @ @R5 0 @kq:r%? \ 0@ 7@yA0S0S RP A0S@`` 0@\ 0 @}5 `㽫H0S 0S 1P|0SX )P 00@\  @ 5㡫\0 8 0@PPf IPM P Q* 8P& @Tr P ᳬ@H 0@\ 0 @b5e @qᝬ? \  0@R@c0\ 0@@ ኬA0S@``i1 \ 0@}`@ժ|0 I(1 0@\ J @ = 's`(1 \ I0@@J P`崪fU0 @\  0@t@ 太E`(H0  @\ 0@b @㔪` 2- M 0@ R kP D1 0@\  @ 7tL @\< @, @ ЍD1 \ 0@@g` @m P@ 0P@@Ѝ Q@-@MA Q6 *Q   QE0S0SFTB 00Ѝ@ЍQ (0 0@Ѝ@ЍPT) 00QP <Ѝ@Ѝ0S(0 0@@ P   R> 0@ ! T00( M/ @t0BmP`PU !M M9 b@ `@pW ừPPD0 |pP  \ <0Hh 0C0C<P1 /0@ Z F?ⰰ[1 /0@  !ݍ Ѝ@`Ёء Ѝ  @ר@P  <0@ 0 <0@ 00CS00$00\& Pc @F L (,00CS񟗭lhT,hhhhhhhhhhPhhh$hhhhhhhhhhhhhhhhhhhhhhhhHhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhឪP 3< 0C B3< PU 㮪Pf8@0 CRڶ#C@ #C Y38x0@ P BQڶB@0Bn8@0 CRvڶ# CD@ # CCCuP@Tu oPo 'l1 0@\  @0a3ި30P$0C?o20S0 0.  @#!<$00Pf0 0@\ 0 @?"㶨@T ,P  \ @ @e3㡨D٩l1 \  0@a@-U 0 /0 02 0@\ @ P&  p  @@@0㐨#D00 $  D0D N0A@᪤#PD0<` 0N@D BL 蛤kἥ` 0@\  @ 0?q0 A^'0 340<  008<0/  BR=ڶ#< ##8<0L\gڶ#<4 #  *8<0  BRڶ#< #*8<0  BRڶ#< ##8<0N^Iڶ# < #  *8<0  BRڶ#< #*8<0  BRڶ#< #*8<0  BRڶ#< ##8<0L\ڶ#"< #  #8<0L\ڶ#< ##8<0L\ڶ##< #  #80<L\ڶ3 <03 I0 A^Z0 3:<   #8<00CS,0 $ D0D B0H@㗣Ụ`2  0@\ @[8  0$ D0D BL\(ڶ3 <03 #80<N^ ڶ3@$<03 !8 D0$ A@0LD BPPD$ D Bጤ0 @ ?D$ D B0C@2  D0$  D Hy D0D L$ k PD0$ D N`D0$ b PD0$ D ND0$ D BUD0$ L 00`D$ D0$ 5Q@-@M< Q1 (Q   QA0S0SBT> 00Ѝ@ЍQ (0 0@Ѝ@ЍPT' 00QP<0S(0 0@@ P   R> 0@ ! $T00( M/ @t0BmBP @@``p M MW ǣP: \H <0p(pp 0C0COPELYN $0 0sP 0iP P@ U T 㙣PT 0 ލ Ѝ@`Ёء ЍI2 0@\  @05 \&  p  @@@0 @T jP8@T ^P  \ @ @=ӡ \ @ @5ơP @b@  @]4 \ P@ @5 @㭡2 \  0@@ <0 0C0C6P;0 _pPA 0 UPP: 0S: S  S  WPލЍ@`Ѝ:L3 0@\  @07 \&  p  @@@00 $P d3 /0@%P4S N. R0`0$R O>00S011040P0 5S , R0?245S S. R # # # # $ $ $ $04\Q" U>00S 0T P# T #T 0S0 R# T  T 0Sd%R V>0S 0?1040?1040X0|5S W. R0Y0\0 0@ @嬠P;-E BP倠 @@ @b@- 5S , R0?25S Q. R$5S R. Rn^\0 0@ @pP<PuGL3 \  0@@㛟5S Q. R0?3,X R>00SNX ;0 S\0 0@ @>P Pᇡ#P P| 4} y 0# S+< )S8;0S4 #+    0 0 4Q M03;0;0003* *dT0:T0Pq03;00` BmP`

ᴞ2 0@PU (P p 0@\  @7 回&  p  @@@0㧞pP 44`S 0,0<4S[ P_uP\4SVF , d̟ᘀ pWr pP44S <4S \4Sr wh @n4 h0@p\  @pe7 E$  PA⪞ 4 z0@\ $@$ ˝ 0S{ 㧟Pp ,- \ @` @Y7p PPp4 \  0@@㤝m 3 0@  3 0@ h4 \ 0@@  e㆝#80<L\Kڶ3z <03 |q0,Q#80<L\*ڶ3%$~<03 Pb#80<L\Pڶ3 <03 ,00L,巛4  0@Yp!\ @?<PD$ 0CD B@P尝P` Bm@`T Mp <0pPC^P5  0@U`` RL RIVd C X R3 RH^f X*0S2 0@ X ۞P0@ 0C0JS 3< 00Cs0S@0iS SDSn GS ASSV@@T@ Ѝ@`ЁЍh5  0@@26 0@ @'ᶛ&  p  @@@0*&  p  @@@0"` P`  @㤛 <6 `0@ E@S S tSb C P6 0@  -@@, P B@ 0S <` `F`F 0@\ 0 @ 6 `㴜V0S <` `F`F6  \ 0@ `@7?P 0S[ @T/@Ob@ `@X PO0 P 0 P 0SL P %\0 0@ Ü@P&@!@ @k 5 0@@T\X ờP`000.  @ ! $s@kt6 0@\ 0 @5!`VP ᗝP T6 0@\  @0Z> t@@ZP 5 0@E@/t6 \  0@@ホh5@\  p  @@@55 0@\ 0 @ 6͛6 \  0@Z@\5 \  0@ @Qy@mSO 0@ 0PP@P@@@@@  @@ P0000@Ѝ@Ѝ@ 0@  @@@@00@ 0@@@ 00000Am@` P 01ZP 00'(0 @̠ 0@` @ @00P@ Ѝ0C00 /0! %@mM R\PP.\  \)  R ' J @= LĠ S̈́ 2 0@ R xP ͔8 0@)  @ 2Ѝ@ЍgfFBaB8  0@@uBm@P0``  M000官Pp 0p 0 00  ៘P  ᙘP#  㒘P  ጘP  ᆘP 0 00pЍ@`Ёء Ѝ0 00p (p) Bm @` Mf@P y@Z⨘(0 , ( 0@,@`-< p@0@0  0 ,岍m = =p孚T⫚, 0`  @|(  @< 0`  @p(  @0 Z  `0 @]0  @ 0@lG  0@̈́℀ ∠ጐp琀` ` `  |l,P0( : ,!IP Ѝ@`ЁЍ) L p  @@@*1@ @@00S (P 0Q0Q 0S/=BmJ`0`pPp==m ZP [)0 =d=̈́dn>./ >  n$(..{ $wpK?2`@=? Md @D=}}-e"-<ͅ$0崏\ 0 T>X>9  4$0  0@巗P] I E A = 9 5 1 -?00>P7`m( `@X R6 = X,0l?p?ĘPx2 = ,0??幘P/ =.\40 P^  @̈́==^ ^//{P#!<@D.LP>@`ЁЍ@㓙00) t p  @@@1)  p  @@@1)  p  @@@1ܘ2@-@ 0@ MR 0P  0@) 0 @1㦘,Π9 0@  Ѝ@Ѝۛ9  0@@+Q@-.P | 0 R 0S 7 @Ѝ0@000P@g/fFC b! CAmJP=``  @@ <  Lr E'  ՘5@  @ 0\ @! -P0 B0jpZڠ   0@R0 &  p  @@@0㒗0S F:S p,Ѝ@`Ёء Ѝ  员0$0$0 ^$0pS xPP  =0C=xؖ$0S0S <  Bߖ0S A1/^. 4/@m@P M)R*(R *0BSP Ѝ@ЍP R )R 7R7 R0S; !S @o0BSP R R R 2 0@PU$ DP (: P0@)  @PP3㸖(R0S !S S    (:  @0@ 60 S S S /}S :S/0S0S QS XS PS@o(1*,! R :-̀- R -,0 s;? Q  R P> 0@"  //BmP`p( M_P2 0@ @T 㵗P^KЍ@`Ёء ЍW)@'`Vk ᡗPP :{Km隈 Mj!*` sKskOo T5 P P PFp0SF@Ta yP g: 0@)  @ 3 pWX: 0@)  @ 3ܕ^3Z.4S0.4h?,* W@ @$:  0@ p0@)  @03㼕)$: W0@, @ :  0@@DX:  @ 0@9^g :  @ 0@-[Am@(`(` PPSP@ ᰓ(PP P 0 0@` Ѝ(0  0@#Bm` @ Ma@Pa @@`㣓( @ ( 0, @ P㏓ 0 `` @{ @%l@0 @v`0 ``pt`b  3j 0@j圀 0P MV0 B ܒuB0 P= MoU Ѝ@`Ёء ЍAmP\` P 0\04P 040MZ@_`P `sKOT@` ЍBm3`!|0@$p @ M0   忓P' 0@ B D 8 A0C0ԡRq w_@8 i  @lTPs{X Ѝ@`Ёء Ѝ$ p  @@@f0㪔$,p  @@@u0㢔BmX4`Htm0@8`骀p@ M0Y sK @@Y<P < T 哒sko V Ѝ@`Ёء Ѝh$ Bm @`@ MJP :\@@0`p㉒͔ 0 @P<@ `t| 04@ p 0  \ T  `0  @P@Y| 0\@ !lݑp < @0  <` < pF0F( ) @*q_∉+,- \ 0V 岑 V0   @kTPskZo 0S -:$  }Π-  !  = 0 Ѝ@`Ёء Ѝ(100:-R=-, S Q 0Q 0S/0P@m M $d  @ @0ǔd  @ Ѝ@Ѝ$d= @ 0@@ @ @m< P M8@$ @ʌ0P夔 Ѝ@Ѝd 2@m@ 0@PMU= ȔP*440@ 㡓4\0@ 㙓 0S H0S (1T( Ѝ@Ѝ P4 #0@<)40@$ @ 04 0@@㡒op /BmP`hu0̐ M0@`\%0\5Y! pP0 0! \YM/0  \50 0 0000Ѝ@`Ёء ЍP-Am.$`P 0  @PP LA B C 0 C ,  @`$/ ЍTAm4@P``MT 3S0  0\0%1%(\+:)\ 0LS& 3S< 0S84S  -!S Y"S S"S SچS/ 0!f\*\ :0LS2 0@ R ̓Pfh0^0Ѝ@`Ѝc"S S9k"S SnSd  S q"S 2 0@ R( 㨓P 0`P@x& @021P h0[0 !S b!!S7 1!S !S!00 Q"S ?a"S. ʖS 0![pP2 0@X iP?0^06`0@x& @ P0ۑ 0!A00' 0!a 0!i"SL j"Se 0!9"Sr %S 0!"SS "S~ 0!!S7 !S00 q`6x0@@6M2 0@ RN P `T60@x& @ 0㇑d008C 0! 0!g 0!~f 0!z00w 0!sd 0!oc 0!k00h 0!db 0!`00]00Z 0!V 0!RC 0!N`T6x0@@ِ2 0@ R= 㳒P `60@x& @ 0*\  @`@Ǐx&@ @O?@ +@\  @`p崏7 x0@Op@@堐`6x0@@P2㖐`6x0@@卐j0AmP@ @0``M减pP 2 0@ Rb RP Ѝ@`ЍV#2 0@ RZ ?P `x&@` @6 `崐`70@x& @ 6 p姐0 Fr &R$00 % ŕ%0Ņ:2 0@@T P `8@0@x& @@6 p僐`8x@0@ p`7x@0@p`7x@0@ Am0`@ MM- @P<0Sf D Ra R   R   R" 0S007S ' R,d0S R   R   R   R   R   R   R   R  R R" 0S007S z. R0`P$Q \ P P R   R   "R  \  ;^7S y \ ,  P* R +  "R ,  \  0 < P:P;P< \ @ L PJPKPL \ P \ PZP[P\ \ ` l Pj Pk Pl \ p | \z P{ P|q Pm0 00ۍЍ@` ЍX R &  R '  R (  R )  R 6  R 7  R 8  R 9  R F R G R H R I R V R W  R X  R Y  R f  R g  R h  R i  R v  R w  R x 0S0y0 $  %  4  5  D  E  T  U  d e t 0u0 <2 D0SAmP``$M @P 0S$Ѝ@`Ѝ2 0@pW- BP@2 0@0S. 7P 8x&@@ @1A P孎pT8x&p0@ @@01 `P囎@AT8x0@ P@(88x`0@@P RQ/AmP0@0``Mp厏P  \Ѝ@`Ѝ2 0@ R ؏PO0^0xp`@@x& @V1@@  C`x8x0@@VҍAm=`` `\ 0S@` Ѝ0@P00;P0J0@9 d490 S 0S/0Am@P00` P : 4)r  4)@` ЍdRQ@-00E00 0B0C@Ѝ0 B CEAm@RP` M$ A\4 2 0@@Tw 5PdЍ@` Ѝ\ `@ @O8 0@x& @m7㠍dAQ2 0@`V P; k4a$` k $`n`P0` Zi_04`@\  @8 x0@b@@2 0@ R2 Pg `$90@x& @ u7Vg\ `` @x&@@ @b7B D`P\   @8 x0@@mPόd}`$9x@0@uŌgsAmP_``H@MP- 8@@0< BQ <@ ڶ#p@3@p #@`000Ѝ@`Ѝy#D0 0DP @@D BD  Ѝ@`ЍAm@``pMdfHP@_㭋PK <W@000<@0 #80p@P0ڶ3  <03 p@08 CRڶ#C@  #C`CCPC000Ѝ@`Ѝ$#D0 0S9xp0@@ szR2 WP x&@ @r9"Ί`5 x0@@_D$ 0CD B @@Ҋ#D0  <0P`0CS000S. * @tpPE 0Sq0Sk 2 0@XY ‰P%0001؈@PCЍ@`ЁЍh:x 0@7@Çy@&  p  @@@05`0@x&0 @G> 2 0@`V らP hx&@ @7>0 a-`̈: x0@G@|9^2 0@X: SP `p岈0@x&0 @=> Ň0 Pb@W2 0@ R$ 0P @:0@x& @ *>㨇0 Po@:c`p|: x0@=p@,@:x0@@*%0Am``MSO @P<< p @PP0LP 0SF tPC T!P@R@ >@T@j0 Kp9 qލ@`Ѝ2 0@`V2 ƈP @0o:x&0@ @P0'3 1&  p  @@@0@ @0d`;$0@$ : 0@'x@㨆0Am``MSQ @p<< P @pp0L P\1SH dPE !R   B/o"`1hPލ@`Ѝ2 0@X1 NP  @0o @0h/:x&0@ @p0M3 岆&  p  @@@0 @0d : 0@Mx@10Bm``S MMr @P<< p @P0P0LP+0S: 2 0@Xl P Dğ ;x&0@ @P0:> ` @0hPލЍ@`Ёء Ѝ2 0@XW ŇP @0o~P1S+ - R' 0SL S6Q j?0SQP$ß:x&0@ @P03 &  p  @@@0' @0dGPuŸ ; 0@:x@㖅0 @h3PaTŸ: 0@x@ゅQ j?0S  @0eP~ҹP{1!RP@!1CPj:-,=  S@P_ MH @@`s[@0D0CS0S M@TskOo V0ZPA_0 㸆#p80< AQ&ڶ#0 <00 #     $  (  "!.   $ D B@D0Cr40Am``MS @P<< p @PP0LWPNdP >Jp2 0@W} R ᭆPLt @V0=====)Xp ᙆPS @B;-0@d^4 I2I -1?, 1c!cs0Q`!0=d1gލ@`Ѝ2 0@`VP gP @0o Tx&p@ @?ׄD$:x&0@ @P03 DŽ>d1x&P@ @3᷄&  p  @@@0Ƅ;x 0@@>T;x0@@7m <: 0@x@+0 @dL0Bm`S M M` @P<< @PP0LPD<0S3 #R0 L0 P0S 0(1V ATp =j0 F/0 R0 (1YP09Y 2 0@@T 㹅PU @0dpލ Ѝ@`Ёء Ѝ2 0@ RP ៅP" @0oX2 0@ Rg ᎅP `x&@P @2: @0O<2x&@ @ 0`):P&  p  @@@0H0Y0 @@x& @a:`Pփ`:x0@@)`dfPw 2 0@ R; 9P `;0@x& @ R:㰃hy`;x0@@2>QPc _p 0@ hOb0F0SP14 <xP`@0@ aP`;x0@@Rd0Am` pMSMx @P<< @PP0LwP@LQ6 l0S3 $0S0 H bPe$0l`@ ``F઄Vx@  0 @`@` 2 0@ RP ᱄P/˃ލЍ@`ЁЍ 0d@_2 0@ R? ᕄP 0o@Nx&@ @*9 ` P$Dx&@ @a9 ` P&  p  @@@00 h@%$D<x0@@a`vD:x0@@*`k-0D  @xBm0` `pSM  @P<< @ PP0LƒPb0SJ (RG z @  R㉘ PtPWYC = (0 +F/0 Ro07P0@(Z R P$ @P@x& @:H @`@@_ 0d@ލ@`ЁЍU88ဪ2 0@ RS ᾃP 0o@wx&@ @9 ` P,&  p  @@@0; `l<0@x&P @9} P R7 ሃP `x&@P @:h(`l<x0@@勁W:x0@@`倁@<Px0@@ `q`<x0@@hBmBP @@``pMW 8PY0Sf <p< @pp0LPb1S P- @+pᗞ> RsY P0h` ,@ qW P- @ vB? RB@T Pt0h` D @pލ@`ЁЍ<0@x& @ 45R0S&  p  @@@0_@Tx ᾂP'0` owp pP⻍ $P 8@U P= 0P @EqPx&@ @p75 v<x 0@4@㘀Ck<0@x& @ Y5|];0@x& @ G5MO<x 0@Y@qcD;x 0@G@f79 : 0@7x@Z0Bm`pS MM @P<< ` @P0P0LກP2$1S P4 0@ U S~PA2 0@ R P px&@  @?" @0hލЍ@`Ёء Ѝ2 0@pW` P @0oDȟ:x&0@ @P0N2 QlQUS hR P@Z R 㿁P[p 㶁PY YQl1$   0($ ,0}4}5pYQ R 㕁P 50@x&0 @v2 45Y:YQi Rx yPz  L0@ 5x& @ 402i&  p  @@@0>[ y#M?0 CAlu0!0I)0! S"jjnXjhhhhhhj"01 @P9U01^ 3PIY< Y Y  dc V*01@7[= 0 CAl601001 0S0(18<9S H@ P 0 (9B  WY  ^ +cp=xP0@@EA R ܀P 5 0@x& @ 40?O$   @}@x& @?   <oN@ Pڱ 8 b#}  b}@@ J bq$   @}=0@x& @ i2 yŸ: 0@Nx@~ @d8@T3 01[(y 9MR01 # @A~2 0@@T: ZP0 $   @{}x&P@ @2~ $   @k}=x 0@i@Y~$   @\}=x0@ @ H~m >x0@@@~%$   @E}>x 0@@3~[ 0 CA41l*~01701L>x0@@~=x0@@v~kP= 0 0  C@%b$   @ }x&@@ @2[~$   @|>x 0@@}@Bm@P`pt@MW"` @Y PrH_@}P <X@000<@0*#80@Plڶ3 <03 p8p@0 CRvڶ#C~@  #C@CC`C000Ѝ@`Ё Ѝu#80NQAڶ3 <03 #80<<@PYڶ3..$.03< #80<@Pqڶ3!$<03 <`~> 0@x& @ a;}}D$ 0CD B @}`}> 0@ax@3}d#D0 <@0G @pD BpGp} Ѝ@`ЁЍ#@m@80<,M N^ڶ3P 0@x& @ F;{&  p  @@@0{`?x0@@/S{7 @Z#D0x0@@F-{Z:x0@@j`"{D @1#D0 <@0F @`D B`F`{$ D B@D0C{0Am P`Mp MS @`<< @``0Lh|Pf P0D Pz2>$#V`PsTQ P EPr?!fP|/Pv/Pp*495q0nT2@ 0@ Rt |PdH_@yP5 8p@0< BQ <@ rڶ#p*@ #p@000h2 0@ R( `|P x&@ @9 `@Pzo6`ލ Ѝ@`Ѝ+`&  p  @@@0z:x0@@`Mz`q`8059`4+z2 0@pWx {P0P oX`V L0~* S!<0MPj 0S2 0@,0YE |{P @[<014@ 01 LDy< :-,= @ S  00*LD !x@$ $, @4 800*#/( D @xs@@p P 9@PTp 0S De`0嬀 S0D 0S ,0 R %{P @ŕ[$ 0@ŅDD DC7yğx&@ @@C> ye<*01-l]`L U|x$ @ @wx?0@x&  @4 @x $ L @lw?0@x& @ j4xh$ @ @[w x?0@x @Hx : 0@Cx@;x01[;012 E@L3x0 0@,0 Pd<$ L @)w ?V0@x @x'$ L @w?x 0@j@ xBm @0 S ` MM`Y Pp<< @ pp0LgyP%0SQ 2 0@ R. yP `x&@p @w:9x 0OPqލЍ@`Ёء Ѝ2 0@ R yP 0oPY`0x0@@wwx&@ @r: `Px&  p  @@@0x1S 4 0@ Y S 0hP& vppW@ |PU_  W㸧V0 Z〒 @ @ R GyP \[0 \ CLWw0 |Mu`5PP  U`z "yPCm2 0@ RU yP `400@x&p @:wŸ:x0@@r`w]"\5 @`7V\5} xP $ `@ @v|x&@ @: @ aw+$ `@ @Pu\x&P@ @: Nw dP`40x0@@vM\5[  ဒ @;\5 KLvu`@$  @u\0 x0@@@v$  @ux?0@x&  @4  w A$  @ux?x 0@@v 0`@$  @u|0 x0@@@vBm@` `@p@@ #M M0 BpS@R:0S << @0N wP R P@ R 5xPHD8S' !- R" 0R0 $xP t00@x& @ ;v  RI#ݍЍ@`Ёء Ѝ00L8S !- R 04Q$0 wP $ 00@ ; x& @kv0$0d8S(0 0S wPTX 0SS wP0S/ wPY 0S^ wPܳ[ ?0ST䣝Z >>0S90pS00 XY00U(R Q"",4 l 00wP00B,0S R; wP , @10@ `x& @ ;u0O _0S kwP <10@x& @ ;u0S XwP ,10@x& @ ;u R  EwP @`P0@x&0 @;u0d i2 0@ R (wP x&@ @; `Qu0 oM10@x& @ ;u:(0x& @00@ ;u#10@x& @ ;vu60$ SR000C @`00@x& @>au00@x& @ ;Wu 0[: OT8 0pS L@T R[ vP `x&@@ @1<6u0/ &  p  @@@0@u@`0x0@@tg0x0@@ t R vP ``x&@@ @$<u1x0@@ t<1x0@@ t,1x0@@ t1x0@@ ut(0x @00@jtr, 4@ x&  @;t@`P1x0@@Rtr0x0@ @Gt! 1x0@ 4 @  ;t$ 0x0@@  1t-8ȟ:x0@@`&tXPM0S$0S<00 24 0RN0X \0PF0 (0S0I0Z0HH0@Mp08@pT0@Z0  uP <0R3_ uPH_@sP? #80<@PPEUq<@PՕڶ3!$ P MP600公0@3`2x0@@1|r@D$ D B@F#D0  cpP 0``3 0@x& @J5np3 x0@p@^n`3x0@@Unz`30@x& @ 5 n`p̴3 0@xp@9nV`3 0@x@-n0n2@m@ 0@P MR pP `30@x& @ ;6xn 'Ѝ@ Ѝ`3x0@@;n2@m@ 0@P MR oP `40@x& @ C6Nn 6Ѝ@ Ѝ\`4x0@@Cm2@m@ 0@P MR oP `,40@x& @ K6$n 5Ѝ@ Ѝ2`,4x0@@Kmʀ@mPǜM\$ 2@ 0@ R* oP `(8 @0@UHPP@0x&0 @g> PmЍ@ЍQЍ@ ЍЍ@ Ѝ`8U0@@PPH4x0@@gPdm0Bm P`S MM @p<< @`pp0LnPa|`V `?o2ZL59 2 0@@T oP+ `@Fx&p@ @7 mp`600L5W2 0@ R nP `x&@p @7mm 1S10$ R^ 2 0@@T nP!ލЍ@`Ёء Ѝ2 0@ R nPomሳ40@x& @ 72mx&@ @7 `P%m&  p  @@@04m2 0@ R nP `dx&@` @7md1,0S0 S V `_ XPr_0 lPk?l#PdQ0 P0F<0s0Sn40Sx (Ru 0P 2 0@ RS DnP `;0@x& @ 7lOa`` 1E4 0@x`@El<4x 0@@:lFp͟:x0@@`/lP`4x0@@&l`d4x0@@lz_( 00(R "z @ 0919R mP 0 0@x& @ `07\lۄ0S ,R : ((᱓$1S . R :'\Q V? R: 'dQ > R: (1S$0k p1R(0, ] 2$,0 0@x4@ @@800@ DHL`P4 0@ Y $+S04@ 0h@>h jp@T nh5 Tz 4&x R 80 R cmP \[0D\E CNtk" p0Wr,0[04@HL`P!>"Pr p@ Rz 4mP0 S <0S0 0S <S $1S >000d0J06/7aPq7/Pk4)R059 80059 00CS  @3ZQ PPV!\5[ ;\5 HL k0S *R *P0Q7@iD0x& @ 4 Ok i2 0@ R' lP; `50@x& @ 79k0@T ixD0@T j Er10CSY$$$$$$$$$$$$ 0 p@0Y9 ~lP R `Vi slPV0S:SSw)`V blPuᘕPZ7SG x&p  @@@7j0 p@0 p@0 p@ p@ R >lP0 ,50@x& @ $7j0P$ .0 BC (JPk 2 0@ R lP `<0@x& @ 8jh: -PX 2 0@ R| lP `;0@x& @ 8wj2`0 0@4@ R" kPb `400@x& @ ;8]jU20 0@4@ R kPI `,60@x& @ E8Fj> 0h@}@(ᄰd50@x& @ 7.j-?0 }Paq `5x0@@i@T0 kP X@.5 0@x& @7i)Z ?x0S@`P;U`P# `V ckP -60@x& @ }8ilIPZ @ 0 td5x 0@@Zi`0(0hT @Wh$\  @Rh$L(0@x& @ [8`ix50@x& @ 6iدx5x 0@@i0`x 6@0@iF R01`;x0@@iᶯ50@x& @ 7`i{`,6x0@@EhO៯5x 0@ @hg`40x0@@;h:@`0(0, hT @g$\  @g$L6[( x0@@, ` hl@TJ jP @btx&@@ @8 P i`;x0@@hk`<x0@@hb,5x0@@$h076x 0@}@~h ,`5 `x0@@oh!t6x@0@ dhr@T( @jPG  x&@ @8@h]Y *jP t60@x& @ u8 `h6x@0@ ,h:ٮAt6x 0@u@ hAm@``MB2P 0@ RG iP6H_@?gPa #80<@ppGW<@9ڶ3 pڶ3 <03 `8@0 CR9ڶ#`C Pw@` #PCCCC@Ѝ@`Ёء $Ѝ70@x& @ 6g7x 0@@*gD$ D BA0C@ g@D$ D B@#D0  @aq#@?pK3($ #00` x& @ 0> ,pai0 #380p>0$  Ͽ/ #80<AQkڶ3 _ZX<03 00f sx 8P< A^oʶ"4p P

`M0#3S?0 R;0S 6S 5``(< x0@@_2X6Xd uaP)j89S Re iaP,8 ^@8Y ` 0@x& @`0>_=`;x0@@`g_3```P< 0@x& @J7?_`<0@x& @ ;?_2 0@ R@ 'aP @@x& @>`@@_@2^`t`P< x0@7@$_`<x0@@;_`;x0@@_'$ D B@D0C_`;x0@@^Bm``P $M Q@$ PU) <00CSn R MR RS)000S   @[P r p@Y, `P!0H*S|<<<<<<R< ~RrS000Sa  @ P + r p@Y _`P0sS wS pS R P`P| @0aPc]R$Ѝ@`Ёء $ЍR00 Rp `R 2 0@0SU -`P0@ aP2 0@`V `P ]$x&@ @>^$Ѝ@`Ёء $Ѝ2 0@ RF _P60@ `P]$Ѝ@`Ёء ЍS9000S 0SS- @{P Q r p@Yc _P7P )P 0P] PPUP px&p  @@@00K^x&\p  @@@10C^&  p  @@@0;^UPP P~YP 0`^D= 0@x& @ b?^O 0]= x0@@]`K^D= x0@@]\PP PHHo᪢` Rj N_P L)HX` @P90@0@ , @  0 <L0@ 0@x& @0<] #P:Pf `XpPW _P p6x&@ @8 p]ZPBpW2 ^P @0aPP.P*qP%P! R ^P P0@x& @ `0?J]wP?0@x& @ P0<]?x0@@P\PEP 0`]D= 0@x& @ 0]: 0c 0\=0@x& @ ? ]2 0@`V= |^Pl ]$x&@ @^?\^`]D= x0@b@}\2 0@ R$ W^P <0@x& @ 60\0@ oPa[PP&P~2 0@`V  4^P$ ]$x&@ @0\x?0@x& @ ?\ R ^P |0@x& @ `0?\P?pW ]P 0`pT]T= 0@x& @v?h\eP"Px?x 0@@ [ 0@x& @ `0!0E\r2 0@0S ]Pj ?0@x& @ 01\`2 0@ R ]PV <0@x& @ M?\L2 0@0S ]P =0@x& @ ? \PZ 0x?@!0@`[(0Sx R,  n]P HX  900P pW ]]P L9P)`P0@ @HX@x& @<" [P\$=x 0@^@S['<x0@@6L[35P\$=x 0@@<[Z$=x 0@@1[ 0`t\T= 0@vx@$[ |=x0@@`[HX :9 0`pV\(? 0@x& @?j[`P9LHX0@@ @@< 0@  L>x0@@Z 0`)\(? 0@x@Z P?x0@@`Za=x0@@ Z!<x0@@MZT?x0@@ ZLY Zo HXgwSʅPUE P@T3= x0@@Zr`PL9PHX0@@> x0@@Z[P+LHX@P9 0@00 R30 @x& @< Z LP90@HX@73>0@ x@JZFP4 A:P R  \P `L9P)0@ @HX@x&= @ ZNP`L9PHX0@@>x0@@Z,P`T@- ^ @Ѝ/@ЍAmP8``0  @MTY@P UXXP0x- @T@D  Ѝ@` Ѝ0 `[P0 \@@cXH@@]X@-@P [ P Yp@@ЍJXAm@` P @` Ѝ[0P1jYP Ͽ X@` Ѝ@m@PMT W ^XЍ@Ѝ0P_   M P0 [04S o[/0S  [q K[0S Y [Am@`MP -Z H00H0Ѝ@`Ѝ MX 00 0 [PP X`P! 04 0S ,00,0Wt`0@ 0 @.11W\DX0@ 0 @V1$W@<0@ 0 @R1W<$0@ 0 @N1 W8 0@ 0 @J1Vu40@ 0 @F1V]00@ 0 @B1VE,0@ 0 @>1V-|0@ 0 @z1Vd0@ 0 @v1V080@ 0 @r1V,0@ 0 @m1Vz(0@ 0 @i1Vb(0@ 0 @e1VJ 0@ 0 @a1{V20@ 0 @]1nV 10@@"Uo30@@}U/10@@>U|30@@zUEd30@@vU2830@@rU30@@mU 20@@iU20@@eU10@@FU10@@BUvX20@@VU<20@@RU$20@@NU 20@@JUl20@@aU20@@]~Ux10@@2vU`10@@.nU10@@:fU10@@6^UL10@@*VU810@@&NUBm`\ M0p4`8P Ѝ@`Ёء $ЍW@  U U T  00$00mU 00C?0H00 Ѝ@`Ёء ЍAmP` `@\ @ ` ЍTV `P`@@ ЍU0%S 'S  0 /& 0  /$ 0 P /0 :i//0 :i//(00/ 0oQnQ R: //fQfQ R:/0) :> 0//0 :,./0 :,./0 :-./0 :-./0) [:--/0 :-/0 :-/Bm:`?p#∩ M0skPK8 @ P @ U 0S 00CS P @7/ U@Ts[wO_ @U 0S 00CS @7/U0凿[ Ѝ@`Ёء Ѝ 0 :eR // / //0 ://Am@ ` `P 00@ @MV@_ 0TЍ@` Ѝ0@- 0@( ( @@\ wT@Ѝ BmP`h p`@p@ \M28L@0@@ WT 2t 0@@\DIT 2 0@@\A8T 2 0@@Z`A `(T2 0@ @!T0S_8h\ 8 @l 0@@^ 0 T p `@@2 0@W@@@SЍ@`ЁЍ ( 0 @0@@\ Ѝ@`Ё ЍS 0( 0@, @@\ S 0( 0@D @@\ S 0( 0@X @@\ S( 0  @0@@Bm@`p MR>  2b 3 X 0`P@`@2@\0@ S 2 0@@ \S 2D0@@ \tS 2d0@@ \hS 8 0@  20@@ \TS 8 0@  Zq 20@@  \=S8$ 0@  20@@  \*S94 0@  2 0@@  \SL9D 0@  2X0@@  \S9T 0@  20@@  \R9d 0@ v 2 0@@ \PPR9t 0@dЍ@`ЁЍ@-@ |RM@Ѝ@-@ oRJ@Ѝ@-@ bRJ@Ѝ@- VR9@Ѝ 0@Am@ P` FR` AR:,`@` ЍAm@P ` .RU:@ ` Ѝ.@-@ RJ$@Ѝ@-@ RJ(@ЍAm@ P` JR Q Q` @ Ѝ@-@ QM@Ѝ@-@ QM@Ѝ@-@ QJ@Ѝ@-@ QJ@Ѝ@-@ QJ@Ѝ@-@ QJ@Ѝ@-@ QJ@Ѝ@-@ Q@ЍAmP@ `p M`JτzQd`@  0@@ @S 0Q Ѝ@`ЍAmP`  M`pXQ@ SQT  ` @@0@VQ Ѝ@`Ѝ 8 @0@ @^ 0}Q  8 @0@@^ 0nQzt@>@ @Am@ ` QPrP r@` Ѝ 8 @L0@ @^ 0CQ@- @P0dS0BS0S?@ЍmS0S @-@J@Ѝ@-@J@Ѝ@-@@ЍAm@`  MP`P9rP 0%  0 Ѝ@`Ѝ;rP p @@ h0@WPBmP` @ @M VqpP% 0@@ t@S 0 0Pw~ 0 S 0 0Pn~T q`P@[Ѝ@`Ёء ЍAm @` CPPqP 0$  0@` Ѝ$0  0@qP @m @ M$P(0 0@00S P @@@U_P Ѝ@Ѝk0 &0 Am P`@Op O(0 ` 0@ @OIP$  0( 0@ @@\ 'P@`Ѝv油P 8 @ 0@ @^ 0P 8 @0@ @^ 0PAm ``PO(  @@P8 P0oS0mS 0lS0SJpT.X.\>@GQpP J0( 0@X @\P@ O@`Ѝ JpmO0X\> 8 @p 0@@p^ 0O@-@0oS @ QPJ0?@Ѝ0fS nS0SJ0?@Ѝ0fS0SJ?@ЍAm@PR` J_@PP_ 0?@` Ѝ@-@@P0/o"@Ѝ:..@-@@P0/o"@Ѝ:.Am P`@ N( @00 R 0 @@ p@S0 0(O@` Ѝ3<0@ AmP`  M@pNo`P" NCp0P' T`V3 `M @ @@\0 @TN Ѝ@`Ѝ 8 @ 0@@^ 0N ` @@ 4@VNDpAm@ ` pNP:-R 8 @0@@^ 0N@` Ѝ `P 0'  `0!`P Q 8 @0@ @^ 0NAm@PJ` P @L 0?\ 0( 0@\ @ @nN@` ЍAm@PJ` P @kL 0?\ 0( 0@\ @ @NN@` ЍAmR@``~pp@ZP @FLM \ 0( 0@\ @ @'N@`Ѝ@-@ MM@ЍAmP@`p MMY`p MpJFKK00@  @ ^ 0 @MЍ@`ЁЍ@- ʌNM9@Ѝ@- ʌNwM+@ЍBm`p.\NPT `@T OP 0@0@ @^ 0M@`ЁЍ. @ kL@P jLP > NP0@.p  @@@2rM.p  @@@2jMAmP`@ ML` @KpJ @ @@(0 @TRM Ѝ@`Ѝ BmP0`x `p@`@\M @0@T`1M 0L @@@@S00R "M *@\BM @ 0- \  S00M!0M 4 @ 0-$ \  S00L !09\@L v 0xl/@l @@S00^ L@LH` 0 @S00Ѝ@`Ё ЍL0Am@P `Mp `幒Dp0@ L0S 0( 0@ @@\ L\@L$Ѝ@`Ѝ>l$ 0@ @@  LBm@`R M(p p@P%L00 R? 8 @p 0@@^ 0cL Ѝ@`Ёء Ѝ(p p@00S0$0 c=S` ႸZ_ s⇿} U=`S00 00 S?ZH  K=S 8 @ 0@@^ 0LKZ` KP0 8 @ 0@@^ 0K.  @c&!$/P !\j$Pos[_"V}P =Sp$j Pos[_ U=pSb Am@@`JPAKU#U)P` JpP @ET@ @`Ѝ J KL@I.4p  @@@:K.@p  @@@:}K AmP@` I@KTT PP lJ0P ` D@kJ J@` Ѝ.4p  @@@:MK.@p  @@@:EKX! @#J0AmPd@@` LP00   J1@` Ѝ0  `S 8 V0@ @ @KVl @@K0 0( 0@@- @@\ K@ЍAmP``@ L0P0@` Ѝ 8 @D 0@@^ 0JAm`pᄀ M*.lN`V) PALPP@TU P ">0@  K,< @ 0@l@ H Ѝ@`ЁЍ 0@x0@ @^ 0J0Am` S SP @0P, `哐0 @@` ЍJ@` Ѝ  >l$  0@ @ @@` ЍoJl > @0@   0i 0Am@"R @P@``M0 \PpO0P@ @JpDPJ"I @ @@ 0@T$JЍ@`ЁЍp 0<#@-| @ @  0@ ! $T 9 w@`Ѝ0@" PAm P`@ H`0P( \P 0 00: P) 8 @0@@^ 0*I@` Ѝ 0( 0@ @@\ I 0( 0@ @@\  IbF 8 @0@ @^ 0H@-@eP : N'@Ѝ@Ѝ@-@RP : N'@Ѝ@ЍAmP`` =@P @6JP MM@ @$@-JP`000@ Ѝ@` ЍAmP`` @P @JPMM@ @$@JP  FH@` Ѝ?H@` ЍqBm"@``0@  @$MPx P@p@0^   r < 0 @\ YH00S Su  0 S 20@ x Pp@P@\@=H\  @F 0 @S000H0S 0AS Z8P<Px L#p@@`4@ R0 - S30-0^0-Y3-\H 0 @\%S00G H'J74 0@\G$ R=N7S 0( 0@ @@\ G 0x p@@'@S00G3 R #4@\ppGx 4, 0@@@( W @^ 20@@ G0200@@ G8S x p@@@R  G 2\0@@ \G 2x0@@㨐 0^@ @ @sG8S 20@@ PppeG-0  4, 0@p@@( ^ @\p 20@@ GG0D0D20@p@ 3G7Su x p@@@R  $G7S 20@@ PppG-0( [ h p`@p@2(0@@\ G@9p S"@2@0@P`D F h p`@p@20@@\ F@9  20@@\ ``FD9(  @@ S2 0@@P h p`@p@F 2l0@@ \F@9 2 |0@@\ ``FF9(  @@ S2 0@@P h p`@p@F 20@@ \F@9 2{ |0@@\ ``sFE9(  @@ S2e 0@@P aF49R h p`@p@20@@\ 48@KF 240@@ @P ;F42 0@@  \*F42 0@@ @ ^PF49 8F\240@@ F$Ѝ@`Ёء ЍD0@@0@@D0@@`0@@JD0@@(2* 0@@ 2d0@@ \``Et@E6 QE{\!2p0@@ E0@@@0(@EL1)@E LLB@.D p0M @^ppE0CI 4@EL0@ S8 0@b ^N @ 0E]0iCd 4@wEL0@ S8 0@@ ^M @ 0hE@ Z $$@%4@@\   0!TE24S'  @p pxz& C 00' @(p\ p@p6E24S4 0@^G @ 0'E^F @ 0E@C 0 @S00E(0 Bm@ 0@` ,M$00( R 9` 0@X 㔼 01@@`@P@0:0@0 0 pS 00D R 0S00D 0zD 0 @S00Di?S @R  D ,<  @0\.D X @ 0  S00D X.@D>S| @R  D .>, 0@\D$.r 0D@S00|D(.r 0X@S00qD>S t@R  fD,>S @R  [D-* 0@ @@^ S00LD.* 0@ @@^ S00=D 0 @S002D 0 @S00'D> 0S .>B0ਏCȀ ,0 @@DX( @ D @R  D?S ? R ,8d0c @@\C-= )R |@\C/R 0@S00C/R 0@S00C븓@ X ?38  ICP YB 0 @S00C X?S}?S ? SQ R@  C 0/ @S00C 0/0 @S00C 0/D @S00C및d @DP 0\ @S00pC/r 0p@S00eC=S @R  ZC 0@/S00QC 0@/S00HC 0@/S00?C 0 @S00 5C @0C?S S 0@R  #C 8?@ \ -C ?L0@ \C ` ?@\B x ?@\B *: @0@@P\0 B @R  B C rp}Z W] @ 0  S00B R 0@S00B 0@ S00B 0@ S00B 0@ S00Bd" 0@ @8@^ S00B 0P @S00B l0@P \ wBpp W. W% p  @@@0aB 0 ,` @@S00]Bk (@R  TB/R @  LB @R  CB $0 0 (0RJ@]B,Ѝ@`Ёء Ѝ@@@ 0 @S00 Br @B})S,[P*2( Bm @`@` P MA`PA ,: P   @@=Կ@U@ @PpA@A,`m@ALf: A^0S `M_VMЍ@`Ёء Ѝ 0@p 0@@^ 0A(fAP, P!60(, A CF0   CR0 C(\PAP((0/(\ @@ S5   Q$`02  00@@  @X$nAPj \(`0+ L P Bz +"  B B %  $ (@@`0/( @@$(BmPQ`p@ @(0 0@00 R2 0@  0@@^ 0#A@`ЁЍ( @00S &jP=S@ E =@T00 S U`m @:=S 0@8 0@@^ 0@U`a @P 0@P 0@@^ 0@U  q@P0) 0@h 0@@^ 0@> ㈙0@#\{P #<P ` ` P V 0S 00CS8/.  @ #,#!8/Z=S@Ử |=@Ty @`Ё Ѝn@>0@ $50@ BmP`pR( @@@00 R4 8 @p 0@@^ 0B@@`ЁЍ( @00Sp E`=S@ @c=t@Tp00S)W` ?:=S 8 @ 0@@^ 0?5P z=S@@&=t@TBm@``X pP@p@ @D\>T 0 @S00>\>Sh/R  0@L0@@\0>]-[8 U- t34` 0@@@p 0*a S 0 0>V  0@> R @> @R  >P U U% p  @@@0>4` 8 p0@p@@㨣R  @ @P>PU ?P > = 8 0@ @P \0w>U[P p8 0@p@@㨣R   e>@@P: 5PUQ 8 0@ @@\ M>- @<Ѝ@`Ёء $Ѝ< => < 8 0@ @\00>X 0$ @S00#>0 8 0@ @@\ >Am@R`` (P P@00S @"00S@` Ѝ P=(0 0@00 R 8 @p 0@@^ 0=AmPJ` `P @;<`@ ЍAmPJ` `P @;<`@ ЍAm@``pZP @;< \ 0( 0@\ @ @=@`ЍAmP`p`^@P ^@P @`Ѝ 8 @0@ @^ 0k= 8 @$0@ @^ 0^=Bm0L$`c @T @@ M`@I @@0 0P@<@\$ 0 @z<$ 0 @<$, 0 @<p@4$ 0 @c<%T 0 @<@%\ 0 @<\%| 0 @<`@<<1a3;J *དྷ[T PXp G ]a-=Rc% PePNR h -=Ե\l0B l00p` +6tЍ@`Ёء Ѝd Pe2 0@ R 9P 84@0@" @P2@8!0  0S S8|- @ @ X0$@( |-p P T A    RY$@ 000C?oQ20SA \ Z*[P 2 0@ $0R A9Pw0P`D Dd XD0\0E00F0=0?G0=H0=I0p FH$002300S00S000S00S000S00S0 00S00S00++M+ @0 !L  PT0Y' 4 %00@4 `(`,00 @@Xp8 < 1S  ~86  0V#0  Y `04PX 0  L XYZ0`0,R5$ 0 0C0R 8P 80< :37Y$@.IXp!Y  @ \ @ 0      !0!0#0S $!p0 l@ 5Y2pp[ 0@p W$0[ R K8PX0@DD0p"0D0E0=0?F0=G0=H0FG002300S00S000S00S00p 0 W p  060p+G0Hh1 00:5 L PTpYL  YQ R 7PxXp\0 p0!Y! Y`0 0   `p0d ` 000 0dp |0@"0 @2?6{h0:80<5|40@@5k d0 0   d0RO 7P?X 0 `@84 0@@P@50@"0 @25("p@ @?5{40@@~540@@w5m"p@ @3 540@@e5R2@m@ 0@P  MR 97P 40@"0 @E350000 Ѝ@Ѝ450@@E:5  /*@-Y@ЍAmP*``H% @p4@P 0p/` P000S_ P@ R @#600@`ЍBmP`\u`@㧯 @Mp@0V @   w3 0V@ B ` V0S 2 0@ R 6P00Ѝ@`ЁЍl50@"  @3 5l50@@4PQ00Co//3P MP3 ZP@ gPM/Pg &P  P /@P&/Z//@-@q|@P$$$@Ѝ@Ѝ0@ЍS J@ЍP'POP/P P3: P3: P3#O<Am>Dh ` MA\2cG  P`R0 R BoЍ@` Ѝ\< 3:\8  RW 2 0@@TC 5P% ``@5&@ @@r0` k4!\ L\ R 2 0@@T4 5P 4Co% @0``@m5&@ @@[0```a56 0@r`@3% @0h0Co``J56 0@[`@3Am@`P$M{0@`S꬘@\O<h >D5P`p 5p0@ 00S $Ѝ@`ЁЍ0 %0J @fŃ p#3ScS2 0@X> Q5P `@4Py6 P0@& @ &1p@3O<h >D5P`p p0 \00S0 %0J @fŃ p#3ScS`@4Py6 0@@& @ 3lVBmP` 0`x0@@&0 @2< 0p pW 0!S 0CS0<00E@`  d4Ln0:d0@$Ql@. /`Pw{v7 0@YP@/`880@@g/p:`0@@P /48`0@@T/E@x9`0@@</D0t0 QPi/>>000@P04p@LPT\0S 0S 03<05:S 0<0 X1P `0<@&0 @2 /@ `@002 & @/`8@0@@PG/0Gt& p  @@@92/`9<0@@./` 490@@ !/Am@P` @` Ѝ@-@ /J&.03@Ѝ0Am`MS < P BR J`0x00H70Ss0P<   BP; V 0S /#3` Vv 0GY 0@D @9Di!V`Di 2 0@ R 0P0 HJj 0 0Ѝ@`ЁЍ000p # pVDy2 0@0S t0P ` &@` @]3. ZJ49 8 0 @49 R"1SCqS59 5)S 2 0@ R C0P 5)P;`0@<d@@R& @3 .pJ#p!\! # ̓ RE H7`0SAJ70S0=0C:0@F0@CW.?#` Uv 0G0@E` &@ @`_3h.JYH  @ ES2S Cr @QSSQ*7 R R R 6R`&  p  @@@0U.R 5)f`; 0@@]-`;0@@_-`P;< Q0@@d;0@@-Bm@`bp `@  MR\ /PL0S/ ( @@ P@0@PS#0S i/P d0 @ - 0 d i-0S, E/P 00@ ,0 @e0-Ѝ@`Ёء Ѝ0@ ,0 @^0- <0@@^9-0 0@@ eЍ@`Ёء $Ѝ*-AmP`p`MP 0S0\ R1 0S:2 0@@TF .0P'V0 Q 0S0 R 0PS:2 0@@T6 .P00Ѝ@`Ѝs0s0@@@ ,0 @@;-0d@@ ,0 @@B.-0@< 0@@ ,00d< `0@@ ,0RAmP` M`Q$ 2 0@ R .P<Ѝ@` Ѝ2 0@ R o.P <0@ , @)0,0@\#0q@S0DS!2 0@ Rh M.P <0@ , @90,<0@ , @  0,UT UT UT  0 @ R#00ST 0T?000#200T 1<0"300S100 200"2 000 0|< @0@,s< P@0@,j< @0@@+a $42@o/0@m$D& S<0;0@ P*PP@ P@002@Ѝ[Bm`p $M*@傗Q`ԡ0 I-#80< AQ#ڶ3 `@< P p 03 0  p0!2 0,$Ѝ@`Ёء Ѝ $ D B@D0C,Am0R P@@ 0`MR`j [-P0P PUm P-P9Ѝ@`Ѝjz='R>: PWRd ;-P `X  -@ @PV0+(07:*` -< @0@0L0L +`@(0@ -0 @P0 +FD-Ϡ 707Ѝ@`Ѝ+:`p L<@0@L+`@(= 0@P @@*`X= 0@@V*BmBP @@``p $MW I ,P1%V% 0 0彸P z⁗YF R] ,P `0@ -0 @v0+$Ѝ@`Ёء ЍJ7S⨼07`p2q0@ -0 @e0 `*`q= 0@e  `@*8  '8d偷?0P" R@ V,P N07`= 0@@vc*`  -@ @0*g儇0x᰷t 0R* 0(,P0D-7 Ϡ0@ 7W*|` > 0@@-*`H -D͚@0  @0@ *`H>D͚ 0@@*@mBP @@M R6 +P ?P R2 +P Ѝ@ ЍЍ@Ѝ`h0@ -0 @0G*`0@ -0 @0:*`h> 0@@)`> 0@@)@mR@ P@M R7 +P: '>P R0 +P Ѝ@ Ѝ;0`0@ -0 @0)`0@ -0 @0)`> 0@@x)`> 0@@o)2@-@ 0@ MR E+P `(0@ -0 @0) (: 'Ѝ@Ѝ/`(? 0@@@)Am`z7MS R` P@@ R4 +P" ~(V၇Ѝ@`Ѝ%>P R/ *P Ѝ@`Ѝ`\0@ -0 @0a)`\? 0@@(`| -@ @0L)`|? 0@@( 07/AmJ\` Q 0S '0\9@` Ѝ00PP0\9\9Z@6 嵸  E*(\ ' PAm`M P@ P` PmxX|L|PpЍ@`ЍR RP p  @@@y1(R p  @@@Y?(RP p  @@@[?(RP p  @@@1(R? p  @@@Z?(2 0@@TS (*P @n P@ @1 `(2 0@pW,  *P Hp  @@@1(  p  @@@_1( P p  @@@>(n@  @c?b @g(n0 `0@c @@'|n0 `0@@'R0Am@`L$  @@M4q@P`W 0 P'P`P T@[&`PЍ@`ЍAmP@`  P L  @)h U>`h l P5T5XU@ Ѝ0Am@ P0R0`4MF R3 R  @'4Ѝ@`Ѝ:$4-8= $0( , 2 0@ RC a)P(0` 4' % )( V':,-0 <=$ (,0:@9 " 0":(-`1 `0@$ ( @0,0` `' `1$`0@@(,p`` p-'0P : L'O @-p  @@@A?'@"&Am\H`HH dM R#22c0B S^2` 0@@T (P ` @ @P1T'.d5 VЍ@` Ѝ`1@0@ &\/2AmP 0@`@`MVf (PIUP@ :UZ2:\9S6 M @ &l 0  @G( Ѝ@`Ѝ\'Z` (H %P %X HiPi%8 Xi%8i%gOBr?SN\9S %\ %0\9Ѝ@`Ѝ@`p~%`@y%0@ 0 @I? `& `@f%p@a%1 0@Ip@M&0 RQ  /0@-@ R R  01S p@Ѝ Q   m\0Am@``MS= U^⏿\@(\60\0$&0PX5PH08  B CX0C0SЍ@`ЍzwP0崇g S PЍ@`Ѝ9L0S Ie 0S0S 2 0@@T% 'P fl @ @0&P  07Ѝ@`Ѝ⦶P El1 0@@%*"4S2@mP 0@@ MR ]'PЍ@Ѝg̓00"4/`20@@Pd%`0@ 0 @1 P%0AmJ0`"TMU[ )0Eps0 0$ 0sS :." Q- 1VS- RR- VP-0V12 0@ R5 &P `h20@  @ < `Pm%3#`Ѝ@`ЁЍV!- V - V-0Vy Xp  @@@1c%`h20@@@ P$0!S AS S ///@-lP@ЍBm\P@`U IM 2 0@ R &PqPIߍ@`Ёء Ѝ`20@  @qP F2$`: pz$.P\ 倲. @P. R [&Pr>.\p? 㲐0@ L੟00 ⎇0 0 R :0 PP r  0 S~ Y ,&P h`^"( @ @_2  $$q P 0S &P(q q P X %P6$0 @A%0\``@$40@   0Z`\ @ @Pa2 ]$`\30@@a#u`20@@FqP#9%(~!3 0@  @629$ R %P `0@ 0 @?$$3/`0@U^#o\0\0"5$0PLPX5%$! @ @12  #l`Ph!(3 0@_P@#%$!3 0@1@|#Q~%(~!3 0@6p@n#S2 0@ R$ H%P ` @ @R2#2/`0@jPn`30@@D#`20@@R;#AmP@\`pM`PP0 d8\3?<02`P04Ѝ@`Ѝ2 0@ R3 $Pn `< @ @P?k#n2 0@ R $P `d @ @P2 `S#`d40@@`"`<4@0@"nAmPUN\` 0\0!U#0P`X5@ ЍX5Am@`pMS UnX!X50X5Ѝ@`ЍP" @`C R $P"000: .$"X5U*Un#P X50CX5!X5U:`40@@`"`0@ 0 @2 `"(1AmPJ:H1` S 0 `  Mx=|====@Ѝ#x=SL-S*TQ0 -d03L-S:-q=r s0棱*p<|d 3L-S::t-R M " t @px-|---- q! @-#@Ѝ0Bm@ P``p QM@! !I :-\P J   @ M$U( ㄦ㠖 @@@N"000@T , [  Ry #P ᣎ0  +"@T 0R ,005 㬦㠖 @@@L@P  "0000P@S  ( " #P R x#P 0 ! 0 !`? 0@#<`@ T "P("P 40@ T0C40("P Qߍ@`Ёء Ѝ 44! + 0 O!n= 3!0S S Co/  P/ 0S@o"(0 Bm @ 0@ P0R(@`ML  #P;` 7*0@ -l` #`ZjJjmX $㬩Z @_psKOU $0SP pwsKO4U`VЍ@`ЁЍ0@&0 @ !4:!60@@! @-M]2@ 0@ R  "P $0@&0 @ G4!@@}Ѝ@Ѝ$70@@G @-@P 0S h0@@0@Ѝ @Ѝ@m@P@PMP #80<L\ ڶ3@ < 03P@Ѝ@ЍCD$ D B@0C@ (0 @m@ 0@@0 &P@ @4 90@@0PX@m MQT$@(@ @@0<P P ? 0@P P P P  Ѝ@Ѝ? 0@(@ @@ , R(? 0@(@ 1 @@ 0!(@  @@ @@]0 4 0 @/! /!? 0@(@ @@ /R\AmP@``6pP @0 P@@`ЍR/@ `ЍAm@ @`pM8P`Q+  yP0P, @0W   `    PЍ@`ЁЍ00@&0 @ 1 `P09p 0@`@Pc Ѝ@`ЁЍBm@`p @ 4M\0X`Y`P(060606 07$0B  P'PL @U0!00娰z 000+"02`+;  P4Ѝ@`Ёء $Ѝ (46(0@1d0@&0 @1 p` b46(0@10,0,d9 0@@` 4Ѝ@`Ёء ЍBm@`p8MⓈT1 b `@ P␗ @ T0  !@0 !0Z  P$ $  @@ C0@&0 @-3 b G p `@oP婒UH  vP PP@! 0@$  @@@&PP8Ѝ@`ЁЍ`VE  UP $  @v&@ @B3 P$  @e 9 0@-@N$ w @S9 0@9@ P@8P$ u @D&@ @93 $  @5!9 0@B@#Bm@` P@,Ѝ@`Ёء Ѝ&0 S @:@0@@F`@p`Ti TI @TzP@2 0@ RE  P@pT TfP2 0@ R$  P :00@@&3 @ @6P]2 0@ R  P :0@@&3PU2 0@ R  P :@@0@& @ 3@P2 0@ R  uP : 0@@&32 0@ RR  aP 0@&0 @ 3@zP (0  0@P. @@l(0  0@pPI B @@X  5P0AS\||H@y@P #80< AQlڶ#0< # p p   !0!0! 0 0$ P@$0-Snz20 @ȅP Q R  P 0&@0 @2 @U R  P 0&@0 @3(0  0@o@P2 0@ Rl  P @@& @3  P%(0  0@PpP B @@0S  P h:p-0@ @t @Q3& @ SP pW>  0@#|:'P pW  aP  h:tj0@`@@R`_0@&0 @3B p(0  0@~Pt 0@D@W*2 0@ R  3PX H0@&0 @ 3 @@K:\ 0@@&=>]2 0@0S  P6 00&@0 @?.2 0@0S)  P# 00&@0 @32 0@ R  P 00&@0 @3R  P 0 &@ @@? @P2 0@0So  P 00&@0 @3h*t @@p=0@P@ + 460@㼪ᰐ1\0@&0 @2 Z0 RT @TJ +XR@ 460@㼪ᰐ1e\; 0@@3.  @!|$pp3Pc`Vl  WP| @^,&@ @2 o<0@@@Yc> @*] P X%  ,PQ `h:t*0@ @@V ``]0@&0 @3B 9>@0@@'0 R$  P( &@ @?&0#0S `V  P @]\0@&0 @2 ` h:tj0@`@@R`~]= `0@@p@:0@@@p@:0@@@$ D B@D0C?0p@:0@@@\p@:0@@=@ R  P 0@&0 @ 2@p@:0@@@ @@0;0@@ @u0;0@@ @jt0;0@@@`j0;0@@@V`@\\< 0@@JT: Ao1(@DH>p@0@@@0:;0@@@'1 h:tj0@`@@R`\= `0@@<0@@@ @\,< 0@@ ;0@@@0;0@@ @;0@@@BmP @`p $MdT0QPXL@0(  P"80P( @0 `P @ $Ѝ@`Ёء $ЍP0@&0 @ b?@ >` 0@@@ $Ѝ@`Ёء ЍO< >D0!aq0QS /@-@R0P @0@@Ѝ@Ѝ 0BmP`SpP% !Lj@0$@o⾕ P sKPOT $0S,0S?]P00c0@`Ё Ѝ@ `ЁЍAmP@` MQ2 0@ RG  P3Ѝ@` Ѝ(0 0@0<`V ``PC @P  Ѝ@` Ѝ2 0@@T'  P &`@ @? W0@& 0 @m2I>@0@m?@0@  "(0 Am @ 0@ @P0` MR(`#  P *0P& @0P@Ѝ@` ЍK46D @0@@1& @2 4D?@@0@@ Ѝ@` ЍAm@P  `` 0P @`0000P@` Ѝ @ ` ЍAm(P l/ P@` @`Mp@PE PI d@8@ lS$P>0 @<@J2 0@@T'  PЍ@`Ѝ 0@@& @@I ={&|p  @@@4&p  @@@4 ?0@@D 2 0@PU  P 0@&0 @4B E:? `0@@@-(@ @@0<0S @0<0 < @Ѝ(0 0@0<P /Am@`` M@PU "< @@0 0R<@0A  wP/#80<@LP>ڶPL-pU<|p:0 P3< Y 0P kЍ@`Ѝ`0@< 0 @ /0`0<0@@/M D0CD B$ @D$ 0CD B @@Am0R P@@ 0`MR`k  P1P PUn  P:Ѝ@`Ѝjz=|'R?: Rg  P `0@< 0 @ P0_Ѝ@`ЍѪ:*`|< H0 @0@0F0L  D`@l0@< 0 @J0 4@-Ϡ |70|7Ѝ@`Ѝv:`p|<FH0@0@L`@l0 0@J<@@`0<0@@PBmZ@` QwMW 2` 0@ Rs  hP$Ѝ@`Ёء Ѝ0@S)2 0@PU  SP `@X40@< 0 @j0 Q0`@< 0 @ b0@ `b0 `@0Z  %Pn0pdpP70&P' R|  P `0@< 0 @ x0Ѝ@`Ёء $Ѝ`0<0@@b`  ڣ|wT R#  PP@-Ϡ 8xG0@t7Ѝ@`Ёء $Ѝ`@tX41 0@j<@@X`1@͙<0@@`\XX0@< 0 @o0 p&~`KXX1 0@o<@ pq`1<0@@x`1< @͙0@ @00 2@-@ 0@ MR  qP `0@< 0 @ 0 J0P7Ѝ@Ѝ`1<0@@n@-@ J0P7@ЍAm` @MT 2P 0@ R6 `3P!Ѝ@` ЍT2 0@ R+  P T0@H" @ 020 0@H"0 @,0 P 2H@@0@,T2@H0@@2 000%1S :44S  AR 0/ R00C?o2/P0i4i4S 0i7/@-\R #\@cD 0 @8Ѝ@h%\ 4Ğ\ @AT d40Rʀ #0c$\ \ d40000%1S :44S 0A0C?o2/000%1S :44S  AR 0/0C P=3000#/000%1S/:4ē\/0AS/- MH2 0@ : ЍAm@`p`,ML00%1S :4$R AQB V $ 0 PPB [$PHT0R !݁r 0 ͕r  0 8P 00000%QU Q:QY Q 2 0@ R P^Pj,Ѝ@`ЁЍQW R R:IP2 0@ R P `|0@H"0 @0`ZX:40SP :40SW  RQ  CSRbH2 0@PIPZ40S( S 0 40Sd H2 0@Q|P`0 @H"0 @1^P@  0 0 H24 0@X"P 0P0o SH2 0@LPd`|2H0@@`{ZH2 0@9PQ:G4H2 0@.P C>0P H 00;H2 0@P2`2H0@@^PH'  %!R/*4$R/ AR/@-+PP @Ѝ@Ѝ0AmP`@`MAS+ Sb !SO,3h.D4"BbQ SЍ@`Ѝzc$R* 000%1SX 8cdDp000%1S z4P  d4R R h$0D2c1R /Sc4S;2 0@@Tq P \ @`P @ H"@ @1P  0S( O,h.DQ 220@"BbQ P4P 0AS c$Q Q0& SS@40@4O,x1h.D4"BbQz Sq0S S S@40@40S= 0c$h4qS!H20@  )@4c$0@4c\ `` @c 2 0@H@`PD@$h @$ R R9s :ZSc*0 Rs0d4* dD'}/H20@  rrAmP` MUL <@AQ)`Aov`VI 2 0@ Rp P[ 0^?s01 <<@H" @LL ?_Ѝ@` Ѝ2 0@ RB P7 ^ <0@H" @L 02=& | p  @@@0K0SPPV2 0@ R( P dH"`@ @2PP3H0@@ <3H`@0@ d3H@0@ Am@`MTz q3H0@@E  `@R:2 0@Qj Pr 8 `H"@G0 @3H0@@K` F R4 R 2 0@ R? PO t0@H"0 @V0` +3H0@@Q` " @@P 0`Q) GP & @-P0`4H 0@@@`d t4H0@@V`\ 84HD0@ @GS `&  p  @@@0 Am*P0`j M RA#0C0*!@0C@C @D@D@D@Dr p@XJ P`V7  P x0@$0 @0 @p  Ѝ@`Ѝ6x4 `0@ $0 @0 `O `Vx4 0@@ x4` 0@@ ` Q: Q1S /\Q !@ a AQ/0ʀ 00/@-0*@0@Ѝ0 00`*Am0P@O `` 0`00@ Ѝ2c1 0@mϠ O 0P@ 00 0@Ѝ02c0  A/:0AA/:*-0 RA#A A *!: 0AA @@Am <P?O`j@  V #.b!!A*A*0A @@@`Ѝ0 0:AmP``M SA#**@1p*@D@D 0 @D@D@D@D@DV 2 0@pW  PЍ@`Ѝw 0@$0 @0 `@7 wA 5 0@@@ Bm@`r` p@ M@PZ~  PTX 00 002cV0S } P!{Ѝ@`Ёء Ѝ  U`e0V# V@0S} _ P Nw$@P @E?  0P0P`F`.w2X0@x@@$0 @ ` R0B`F0`p w2X0@x@5 0@`@ # rP`Pv50@ `$P0 @<ji !iv5 0@E@P v5` 0@P@l !D 1 *-0 R#0C 0C0C *!ʀ 0CC@@0Am@` MS: S02 0@PUj 0, P 0,P8 ` 7 0@' @J0 0L&@P @:0 Ps Ѝ@` Ѝ' p  @@@0 2 0@PU" 0,W P 0,P` l7 0@' @J0 L&0@P @`r l7 `0@@G `c 7 `0@@8 -R M 70@  ЍAmP` j-\ MPT 3@T ]T "%PT@` ЍQ/AmP:-̌=`M\ 0QP\2` 0@@pW6 0, PU Ѝ@`ЁЍ0,pq u0@'0 @0 P1 U0@PL& @:0 PK u7 0@@ P0Am*-\MP`MT p jp@O@T 0S 0 \@TЍ@`ЍQ/BmP@`z-\ =PMU 0U Q0 q@U2 0@`Y? 0,7 PTMU n@U0~@@L& @:0P#Ѝ@`Ёء Ѝ0,N t0@'0 @v0  @T 5 t8 0@v@ @Am``Q M Ѝ@` Ѝ@P@7 0@, :-=^  0\ SR,2 0@@T1 0, P 0L&K@@ @:0P0,@S` H8 0@' @JJ0L&0D@@ @7` H8 `0@J@AmP``GM@@0, Z M Q0L& @:0aЍ@`Ѝ2 0@PU 0,N P 0,Pp 0@ 00 L pp 8p 0@F 0/AmZ@``MpW! 2 0@pW] 0, P 0,pC 8 0@' @ 1|V0 0*" ` @ 0PU( 0,P 0,P 'p@ @ 1 `U7 0@Ѝ@`ЁЍpp9 pA0@ @`8 0@@0 ~"0Am @P :@``RM: T, 0,P 0,4prsT0@'0 @1 p`7 0@LЍ@`ЁЍ`P Ly p@T p?sT9 0@p@ `^Lyp@AmZĕ`$M|$ )c0*2F Bz)p@Ol>nDL LL"*b"b3##2P0#31BT 2p 0@` R P$Ѝ@`ЍĕT `P@+0 @! @p{`T; 0@@@ pAmP`z嬏`0 MQ2 0@@TP PZ Ѝ@`Ѝ x!2 0@@T` P @dO@@+R: @ Ġ `+=Xʨ!0R2 0@@TG P @9,+@ @Z:@-; 0@@ F@P@+@ @F:@ ` ,;/OA 0@ @R Ġ o~,< 0@@ Z@P`o0Am@ 0P``M2P :7S Ѝ@`ЍZX>SżX2 0@ R` P `| +@ @)7V b `@ R` P2WPEUW R_ PЍ@`ЍSڀ"P @S PRP P'W` +@ @P57PǗ0`@+0 @s> L@?`|< 0@@)`(+Ǘ@ @B7`@ P'`H< 0@@s`< 0@@5`(=  0@@BPAm@`pM`6LQ\ZP 7 jm t7S07Ѝ@`Ѝ dZ 0?E&  @-p  @@@0+`@-p  @@@F0 Bm`: ,M⸟Y0 @`0DTJ 1T. T^$ @h ! $ULP 04pWD;PE"2ᑳc&S S000 0200Uء",Ѝ@`Ёء Ѝ0SS009100Q @PԢI p@I *q " SU  #e}  T 0+P 0 `  P ` P100 @P100 Q00O04D#2ᐳc&S S 00h@L 0p W 0@P ! $FKP  O<4>D#2#c&S S `` 0SS` QQ`  Q @R S S 80` 00@S`````P @KV`3 `#P@-0M  A 0 0Ѝ@Ѝ0P /P?5PAm@`j 00MT000M70 @  @]0Ѝ@` Ѝ\0Am` SJ @ J7PxZ ~7S0`7@ Ѝ p@-@M0 EPЍ@ЍAmP `@`4M;P :7S 4Ѝ@`ЁЍVW V V5 + p  @@@.>1S S. |m0c `@p /012. 2 0@@T`  PB2ʅHJP @SP0(C4?001S $S0c! p"/000@Sm`@.0m`@0.0""#0 p"/01 .0pm`@0.0`@j= 0@/  +2@ @` /`Q= 0@/AP @ K)Ppm`@~ @mM^p0@I 0000%1S0S S- T' 8@0P @CT\C@PC3@ Ѝ@Ѝ0000SOhPD2c40C?o2S 0T000 0S SO<h>DQ2cBSS00$@T :T 0S 0 0@0 0S`0@@O<h>DQ2c4SS00+Hp  @@@8CD0DQ2c4S ^0 `Ѝ@Ѝ00008@0P@CT C@PC3@ F000CD0`= 0@ @W@-!P@Ѝ0- S \ % @ ! $0C04> 0@ P q0S7 0@S 0 S 0SSw?9w?@ P9w?9w?Am` M@P P 2 0@PU P@Ѝ@` ЍP``@+@ @i0 ` H``@> 0@i `@Bm` ` tM(Z Pr p@ 8<0@ , 0C 0$ R Pw> 0@㓄$!L$@G P! , @P, 0:$00@S_ 0S zP7S- nP3 7SA S. E 40P :N7SO<4 >D#2ᒳc&S S``P@T NP( 8|0@+0 @7L7SQ @@ @DT@ 3(0C@3@@c tЍ@`Ёء Ѝ8 0 u$,00 @07 +  @o, RS! 0?0Q :p AàpP  Pp\ 0MQ DD$P0T XYZ084 b 0( ,>0 0@4 @$ %(n6&  p  @@@0I `V P6 85P `>@0@+ @(7 l`V $0P& 8` $0`@+ @7` *@9EE+X R fP `0@+0 @7 0SF0S} OPS^Pp S2@0Q4S0#E9%*0D  @70XE90SW P `+@ @78 $ d$ `>0@  @ 8`P 0@+@ @ 7Pm8}@ D`> @ 0@@ h`P8g@? 0@ P@y`>  0@@d`? 0@@[8H|> @ 0@@-pMPX@P #80<@@L+\<@@ڶ3@<,03Ѝ@Ѝ& ,p  @@@*2,@D$ D B@0C@ BmP` WM$h  q@P r p@`V/ XP0S 0 S :0N7S< U`P@ X58@ 0C BX5+Q ,,PB{3P@P ,0P3 0SL P0p CR0 Cp ` Pn Wߍ@`Ёء Ѝ\P £U`P0Sr P hP0 0S0S S0S' SO<h>D2ᑃcBSS00 R0S SV 0S~ < 0L)@0Sw`O<>D* @1cc0P0S <0/ @1P 055 :U0000 0@0N'R\P WDP X% BX%0@T @X 1S 0 @>XPh, 0< S  8N^0u0<0P @ 08<NUʶ#4<0 Q3 @u0P l4P hPp0P  CW0 C&`P~ 8P_  0S`O00ĞD00P@&0%멑0ii 0S%U>P0:00N'R\P ǢP XŔ0 @LXń'> PUha>P x xKP #P80<AwQڶ3x <x0R3x hP0p  C0X C0`0p P `@\+@ @{6@ >``$M0@+0 @6B .S`@$=+@ @7@ Q !Q&P^ Y:Pd! 0l4Q1 < - B Rr0!  00 4{`$hP +@ @6@  iO<h>D2ᑃc40C?o2S 04V R 04S 4S040Sc2 0@PU >P% $P d?@0@+ @(6 `$? 0@ @<`@$ ? 0@ @@.#D0,<@0L @D BLQ@  P `0$0 0 @+0 @6 gV 0 R2 Q <00CS=6=P+Hp  @@@O5bO<h>D2ᑃc4SS00_`0$0M0 0@@ {<0S[0S ,0SpRF <A0Pl 0 4`$hP"? 0@ @ l4SI 4.SF$04RA`P= #80<A Q3 -< P hPv`#&  p  @@@0$@ d? @ 0@@](x ^[0/0 00:X>7/ L7S /0S0M'RBm% P@` `|0M4S '&S8 'S2 %S 2 0@ R Pg4 0@pDЍ@`Ёء Ѝ!S $S S *pW ip04r  p@0$  Z P  0)@*4奩c02F@ΒJ#:cDP S@>SLD>QH 0H>LUx 3+S@0, #0<0>  0@ k#, P!$ @0P(00 S8 8 T  0P 0G 089S 0S> (sP&8 n2089$00@S D)2R00%1,0 0S H9S Lc ʠ"F)@J"*bR H)+P9S Tɛc "F)@ Jʂ"*ᑢbR P)@ P( @)L0@  H)R P)R 0(0@N0P T9(0  ( ( S$ #8<@Pڶ@ <P P   L'R-, R$0 0 P0 @ QQ  'PUv Ppp4 P2 0@ Z? Po/c0) @2F )@ƒ#:#aK0:`@ `FV3 @ 0Cs0Q3@F  \j S Q< P @ 0S S S +Hp  @@@&:Q   tppW3 W AP2 0@ Z hP|ፈ0Sq0 n p"`r p@ Z OP00S SZl$  @XP O<4 >D#2c&S S*pW  .P 0@+0 @: p 2  `C3 P` EX X 0zp `PI  2 0@ R Prp)  @pPW  ܄pP0:  U2 0@ R P p@+ @e3p>0S5 V6S#80< AQڶ3 < 03+0  8_P:0@  !0 !01L΂0H>0: /="0R=0=&  @P =0=8Py0 S2 RZ ]P>(1VN pW RP0 p: YCIpP2 0@c Y 6P8᠈0S>0 ; 0pSk)(1PI 2 0@Y Pp p H+@ @? 0P(0 NQ O<4>D! #2c S&S ( UP X5 0CQX5  P^ #80<<AL\ 3< < 0 B3 X $0@+0 @74 4  cR0@+0 @: N 0@+0 @: ^ ^\B \Oh`D㜧 |lB\\\ jS R !RPj :PXj4S0 0  3$-"\ `0@+0 @9 P $<0@+0 @4" P#80<@P#ڶ3 <  03) 8O,4.D0!a&Q Q p03: |`V P^p ^p+@ @>v9 0@@@T pP  pt@ ;l30@+ @> Sc ) 1$0@ 7@d3  0@@d2 0@X| P pN`>`0@+ @3 0p: ?0`3 0@ @p@+ @3ptp $<3 0@p @|}@ 4P0:L05 Z j#80< AQNڶ3 < 03<P 0 0 00!0!0G:?JH'㰐0D  @0 pJ#` 0.nl\: p 05 Oh`D㜧 |l4Lo `pX `0@+0 @+3 m`@F 0@+0 @? [pYU PpX  P p`` 0@+0 @C3B 7Z0@+0 @> $O+Hp  @@@r93^w $#0Sq S0S 3 @ N7S   p0 ⶃ@Sz 0@1@044 X `p `1 0@+p @v# `@ 1 0@@ @h 0`0,0(+@  @0,00j4@Te 0pP4 `@ d? 0@+ @pf4!0 0@@p01 p0@@ep'1 pR@ 0S 0 :  pW@ P 0@+0 @: d p2  `C3   0a0@ 00m4  0@@f#80< AQڶ3 < 0380E)R @007P0@9 30(0F9 S  R (0P(00F9X9S #  X) S @ P P   7S0 S 0 @S 00S} 0000%1Sv#80<@PQڶ#:0@<  #!P0 P!0YOh`D㜧 |l4\\ 0` , , 2j0@  @( E3 0@ @: T40@`+ @ 2+Hp  @@@9D$ D B0C@p` Ql3 ` 0@@p^`A+`@ @&3 Yr p@`V= Pc 4"Fʠ)@9:0C"j6fPVpW P7. 48V/   c@)@J3p BF)*`B Q Q0 Q00 BV Q2**j2ᗣcCCZ[-0CS000 : "=S h 4c2cSm-L@Tz 0PP0@`V 0SH0S}p 0ss{⇟ Y R RM @Y@ 0A0R D$0"@$0@Z  p``> ` 0@@>& p$0 0SH0   D0D B0L$ @T4  `0@@OP?D0@ 0 0ូl 30 @ J4P\@ 0 YV 0 x3x0 @ 54PG@ CX@ 0SS R P0F9'@ PL0( PT         P  P    '( ( X)@ UPL0@ 0@X 0#80<@P_ڶ# 0< =#5 50    !0!0f(0`^   $0 0@  @0  P04D `@@p 0A T@@`P + p  @@@/=*-.R M0< `[5 0@ @o`@K5 0@ @@{ uAm`p`MP2@ 0@UpW\ P8Ѝ@`ЍPU! P8Z4P 044< P 0<9 +.0 Ѝ@`Ѝ`86 0@ @`@+@ @; @ `P80@+0 @>" `@6 0@ @@~Am@``M(2p 0@PU PP `PT0@+0 @;" 0 Ѝ@`Ѝm`pT6 0@ p@FAmP``M2@ 0@pW5 P 00CS 0 Ѝ@`Ѝ>z< P d0:->S<9 B< `pQ|0@+0 @; h`A|6 0@ @Am@``LM0PS xpP2 0@`Vb P+ `@+@ @<@ 12 0@pW3 PPV$0 A ,0P   !dLЍ@`ЁЍ6V`0@vp@p0@+0 @< p`6V0@ᤆ@6  0@@}`@6 0@ @@p*-0/0C#N^-S AoS0 s0Ws 0c0s0P0AmPP ` |Xg@@ p@`@@ pU0 @ @n0S S d@00P p@00@`Ѝ@AmS`p`@@ PWMp @a0S2 0@@T PL0[ 0/020 EBЍ@`ЁЍ 00X 2R0.Rht! T:0S7 0 00a@0Do20 0W2 0@@d Tw PLH@?00P 8a0@|'0 @t0 0002 0@@TA kP 8|'@ @l0 8a7 0@t|@mx|'p  @@@080@|'0 @0 pT/ 1PP_87| 0@l@?J88| 0@p@38T0@|'0 @0 p8T8|@ p0@P)RBm@`p $M XW]gP`@2 0@ R PB$Ѝ@`Ёء ЍXW]g,P`@(d @FPT 0X +@ R H  r p@a R{ PN[ ]lllX0@|' @00 0S S00D@- @P @@$: ?RI@TW hP" r8 @ a0@|'0 @0B \ @h g0@|'0 @0B   Va80@ `|@By0 P0  &8 \79 `|0@@$X8`|0@@ BmP`p` M0 0J 2SMM,@@s;Ѝ@`Ёء Ѝ'S @@Z T00: 0 ̠H,@ @0C 0h2 0@ RM P \0 P0 Ph9|'0@ @B?  08Z5 "0 @ R$ 0}P0 @0 0@|' @ 01 yh9|0@@Bz9|0@@o2 0@0S IP 9|'h0@ @F?  F 9|0@@F FD@-@ , @Ѝ0@m @S00 E2?\2C "@Ѝ20 #`d0@Ѝ Am@]0`$P  J`' :  0.p@` ЍBm@``p tM0MTP Z7StЍ@`Ёء Ѝ00CS4Hh`߭(t0H0H0 0R s0P0=8S p0 @L0[  P8S0C8'0 08p0ST0pPkH0 R*  R' H0P !QV' {[[ 00X0p\[-|pT0XS @/o" Q00SSZ  T0NPD `0h*p @@㉨Ll0X0`dSLhH0gPfF/DT0H ,&oH 08<@l0@4 Afd`LbL @X0|`0bh` |*q @0I1 ,`8<\088߭(d0H0I0߭(ASD0$0H0A0߭(AST040H09|*Hp  @@@0 ,7 H<0)8L`T0(X%\"H0gPfF?.&0H`0?` AcX0qN!bT0\0r p0:0@( |* @00 $,%PU  P `@ |*@ @0@  (`0T `0X\H0g PfFƿ0(0?HLcT0`|$| 0:@ p0@AkX q\r7'X0L0SS3\  cRX0cQࠡ࠱~ {PU  2Pf `X@X0@|*  @@ 01V !Q'K{`V  PE ``H~|*@ @`0 @sX  P/ (`0LL T0HE@BHg&P0f&FSVo8TC1a@B!fsPL0@X 4r|* @0>1p $@( ,0PHXS`@1; 0@| @l`h:0@p* @LhXTQ L `dHg6Pf6F < ᓬ oL,| Ln@l|H0Hh08NafTXv`08<0@`I p4$d0`(f`X;| X @0@ `pH; | 0@@p@p(`0LL T0@Hg6P f6FR0VT0B!noXrPL AafH;v> |  @0@  p@$(P,?WAm@]0` P  J`L j1019@` ЍBmJ8` TMSF r` p@P R  P% j$ ,: @0@@Q0`@? ?P0<0@  |* @0z1 Oj4(S0؀X0R? (R ,)R B,)TЍ@`Ёء Ѝp z Q,)K:( R0h`19V@0`VI R  P4 0)ph`0@@1 VD P PHL0 p8@D H@0L000@1 |* P @` $p( 480i0h`AV19`V@0pW  JP ` p0)19H@0D `P@0HD pX@` |*m? @P ,0ej$: , 0@@@Y`70@??Q<0@|  @z-9  69 $ *(h0Z3# Zࠃ^` `A jR``V``0phV@@  D0HL p PD = | 0@@H@L 0 `pP,H` D P D X=m| @0@D@ (  P$Bm P@`  p`U0 & 2P005   E PP00$p%`&'() *0+4P6789 :0;DFGHI J0KTpU`VZ0j0z00WXY [dePfghi kt uvwxy {0@`ЁЍAmRP P@@@ @` T" ``````p`p`` O @@PU d? 0@-0 @PPP@` Ѝ$0  0@@` Ѝ$0  0@r@` ЍLBm$@ _`p @@`n p DM @P@`@N/ @20x" @@(K 0 0 0@80 0 040 q 4#`w}@1 < 0 00M 0 ( +p tPx`P4D,2 0@p 0@t2 0@n2 0@J9" 0@ @ @ \"? @ 0@ @T @ O@<2 0@ @0 @0 !@01:"2 @ 0@,2"9 @ 0@ +!2 0@K!? 0@ 804 01C11040 0/ @@0 0S S S 2 @  0@@j00x2P40  0@ PPPTr( < p@o0@  `@%0SK(0 P 0@ tFP Y P@0s (0 Pj GP_DPQ{PE Z-=Q *!R 0SQ ^ 2 0@ R /P0 @:Z ZQ 2 0@ R PPy2Z/0:P  "9 0@ P0:P @| @x @t @p @lIP0SF 0S40S K@`Ёء Ѝ2t 0@ @$K$KP (l 0 @@@ 2t  0@ @`@P<  @ 0 @t2  0@@ 0: @= @PIPm0S <0Sڭy2 @P0\/ @ʌm1㼏 Ϝ @R P@\/ @c1  P'y5 \0@ϕ@mh75 \@0@@c`P @O\ @Ht  0@@@>:\  0@2@  0@*  0@" $ 0@4 $ 0@  @   0@@(P  0 @  0@| , 0@ @ R 0P0S 0S //AmI @@` R 0Q0Q 0S ' P @P#0 `@(  @` Ѝ`2Am@ 0@`P`MVF P#P@T Ug p p`@ITP 0U 4PM\0 I@TЍ@`ЁЍo' 0 `@ @ x @xpx @s 0@' 0 @<0' 0 p@ @ x @Zx @U7   0@<@B/x @E R 0Q0S 0S //Am@ `T 0Q0Q 0S ' `P @<q0PpP`@05@`ЍpT0S:T/'  @-p  @@@z0l@-T0,@ @S :!P !T $ @@Ѝe'  p  @@@0IAmP`` P@ T@4 @`@ ЍG@-O' @@0 @ X@ЍBm`̹ @p M W7 ? 0@ @0`@TD @$@T! TPUY( gP  P0  @0&0P ' @ @P 0@TQPp WЍ@`Ёء Ѝ P0  @0 P8  0@@ J@-OP0 @@D(  @ 0MЍ@Ѝ0A@-MS6l ,< : @0 Ѝ@Ѝ 7 @0 Ѝ@Ѝ @ @0 Ѝ@Ѝ = @0 Ѝ@Ѝ2@ 0@ R P) Hp  @@@D0c9 0@)  @C0A9 @0@@C@-MQ7,\\ @0 jЍ@Ѝ @0 ^Ѝ@Ѝ @0 RЍ@Ѝ @0 FЍ@Ѝ2@ 0@ R nP) Hp  @@@09 0@)  @09 @0@@o@-MQ7\,, @0 Ѝ@Ѝ @0 Ѝ@Ѝ @0 Ѝ@Ѝ @0 Ѝ@Ѝ2@ 0@ R  P) Hp  @@@09 @0@@9 0@)  @0q@-MQ+LLL @0 Ѝ@Ѝ # @0 Ѝ@Ѝ & @0 Ѝ@Ѝ2@ 0@ R P) Hp  @@@*0C,9 @0@@),9 0@)  @)0Q@-M0 Q@ Q 2 0@ R> P.) Hp  @@@W0 S @0   ;Ѝ@Ѝ M @0  .Ѝ@Ѝ P @0  !Ѝ@Ѝ9 0@)  @V09 @0@@V]Q@-M  ` @0  Ѝ@Ѝ2@ 0@ R $P 9 0@)  @c0) Hp  @@@d09 @0@@c&Q@-M  m @0   Ѝ@Ѝ2@ 0@ R P 9 0@)  @p0d) Hp  @@@q0t9 @0@@pQ@-M  z @0   Ѝ@Ѝ2@ 0@ R P 9 0@)  @}0-) Hp  @@@~0=9 @0@@}Q@-M  @0   WЍ@Ѝ2@ 0@ R P 9 0@)  @0) Hp  @@@09 @0@@@-@QM T  @0 Ѝ@Ѝ2 0@ R HP 9 0@)  @0) Hp  @@@09 @0@@J0A@-SM @0  Ѝ@Ѝ2@ 0@ R P 9 0@)  @0) Hp  @@@09 @0@@@-@QM T  @0 Ѝ@Ѝ2 0@ R P 9 0@)  @0P) Hp  @@@0`9 @0@@0A@-SM @0  yЍ@Ѝ2@ 0@ R P 9 0@)  @0) Hp  @@@0(9 @0@@Q@-M  @0  BЍ@Ѝ2@ 0@ R jP 9 0@)  @1) Hp  @@@19 @0@@lQ@-M  !@0  Ѝ@Ѝ2@ 0@ R 3P 9 0@)  @1) Hp  @@@19 @0@@5Q@-M  F/@0  Ѝ@Ѝ2@ 0@ R P 9 0@)  @1s) Hp  @@@G?9 @0@@Q@-M  %!@0  Ѝ@Ѝ2@ 0@ R P 9 0@)  @J?<) Hp  @@@)1L9 @0@@J@-MQ,,, 6!@0 ^Ѝ@Ѝ 9!@0 RЍ@Ѝ2@ 0@ R zP) Hp  @@@=1 9 0@)  @O?9 @0@@O{0+  @ 00S  P /0/Am@[ ``pP@N  @0B0S P 2V 01qg" @P@`Ѝ 077/AmZ7`$MS0C7$Ѝ@`ЍR00C4DžB5\0S00`s@2 0@@p t@Q, R@  P p*>`p @0@hL@T@@<.u0 @ @`GG|0Cs0 S 0R,  P 0`@<.0 @ l0P`)p:Q`0@h @!L>@0@<@ 1 @@u`G`><0@@Bly/0 #-0 $ %#-0 $ %#Am1 P``t>0@pM ;(@T tn3`@0 /@TЍ@`ЍQAm@`` M QPt @0 Ѝ@` Ѝt. p  @@@0 0#Ѝ@` ЍA@-0MQ/  @  r%Ѝ@Ѝ$ @% $tv @0 Ѝ@Ѝ Ѝ@Ѝ$Ѝ@Ѝ(t.Hp  @@@}0nQAm`` MP@(tK @0 Ѝ@` ЍPt.Hp  @@@O0J/0 #-0  !#:AmM`-|pMT nP`@240 k3\0 d@TЍ@`ЍAAm@`` MQ><    r0!1Ѝ@` Ѝ0$0P!1($ @0 Ѝ@` Ѝ 1S  Ѝ@` Ѝm0 5?op2 1Ѝ@` Ѝ>(.Hp  @@@0Am@P0` 0PP0Q @Q :h?S @@0`   !@Ѝi"QAm`pM.(:-lM`V@V 00S :1PPP@Vd @0 Ѝ@`Ѝ+.Hp  @@@h0\QAm@`` M QP @0 vЍ@` Ѝ. p  @@@09 0"Ѝ@` ЍQAm` M) Q@!L@Z p @\3`sK0 `OYT0 7 Ѝ@`ЁЍ@/ p  @@@1 !Lj@_0 @lP@3p!sK0 pO.TAm0` @o M`@p!LZ @\!sK0 pOT Ѝ@`ЍAmP`@0  M$%!T Ѝ@`Ѝ!L@oZ @\`@qpsK0 pOTAmPA`@p$M4` Qhh0%0"0S <U :0P`p`@oob2 0@0S 0,P( 0,ps%2d@0@T/ \ @@^X@V@/0 @00#$Ѝ@`ЁЍ0 ?op2$0$Ѝ@`ЁЍ&0SY2 0@`V 0,}P 0,`%pp? 0@@/ @04 $Ѝ@`ЁЍr0%0$Ѝ@`ЁЍ#"!Lz@o @|`@3PN sK0 PO%T%0S:2 0@0So `d@/Hp  @@@0,00U%G`P2 0@pWo 0,P 0,pO? 0@@/ @ 0`@ @0 V% p  @@@0(2T/W0@ @ppV@ @%"d @@?@ 0@@^ )\@rrp@@jpp? p@0@@EZ? A@0@@@-@P @D000$ %@ЍAmP` M QAl@@@@@@p@o`@%M 0`!LZ  @\3p, sK0pO<T Ѝ@`Ѝ!Lz@o @|`@3PMsK0 PO$T@/Hp  @@@`0 Q- M  1  @@0 P Ѝ@/Hp  @@@00 0 =w0 =oAAm@P`` MQ`T0H RT \ @0 Ѝ@` Ѝ0 ?op2<0Ѝ@` Ѝ$<0S 0 Ѝ@` Ѝ0=0 \ @0 wr0=0Ѝ@` Ѝq Ѝ@` Ѝ\ Hp  @@@0- * 0SAAm@P``MQ񟗅$TT8TTTTT||0H R * 0S\ @0 &Ѝ@`Ѝ0 K?op2<0Ѝ@`ЍT$2 0@`VN 0,<P 0,`pqp0 0@\  @u0<0S 0 Ѝ@`ЍF0=0\ @0 r0=0Ѝ@`ЍЍ@`Ѝ\ Hp  @@@0p+p0 p\0@u@@-@KP G0P @0000< =@Ѝ/Q@mP M Q Ѝ@ Ѝ\ Hp  @@@V0K@#0H R \S @0 k Ѝ@Ѝ * \Q @0 Z 0SQ Q- M \ @0  F Ѝ\  p  @@@0  0Q- M Q Q \ Hp  @@@0\ @0   Ѝ00HQ \@0  Ѝ 0S/0 0 %-0 $ %-0 $ %}Am@A`` M=D 0CQ=!!P!(!r0%0Ѝ@` Ѝ0P%0h @0 Ѝ@` Ѝ$ R  Ѝ@` Ѝ ?op2$0Ѝ@` Ѝ"h!Hp  @@@0]Am@PA`` M D @Q;#""t"r0%0Ѝ@` Ѝw0%0phu @0 eЍ@` Ѝ$0S  Ѝ@` Ѝ0 ?op2$0Ѝ@` Ѝ"h!Hp  @@@|0 Q Q- M h @0  - Ѝh! p  @@@0 0Q@m@ MPJDi"t;LQ hM @0  Ѝ@Ѝh!K @0 h!Hp  @@@P0/0 0 %-0 $ %x-0 $ %mAmPA`p@@ M6`;3  0 0T `0 ` Ѝ@`ЍAmP@``p M:DQ;&l&$&%w0%0 Ѝ@`Ѝ0%0 @0  Ѝ@`Ѝ$0S  Ѝ@`Ѝ0 ?op2$0 Ѝ@`Ѝ!!Hp  @@@0*AmP@``p M:DQ;''l'D'w0%0 Ѝ@`ЍC0%0< @0 1 Ѝ@`Ѝ$0S   Ѝ@`Ѝ0 K?op2$0 Ѝ@`ЍT!!Hp  @@@0QAm@`` M QP+ @0 Ѝ@` Ѝ! p  @@@0 0~Ѝ@` ЍQAm@` M"P`"! :Q \ @0 Ѝ@` Ѝ!Z @0 !Hp  @@@_0v/0 >0 %7-0 $ %,-0 $ %!AmP@``p M(9DQ;D++**w0%0 Ѝ@`Ѝl0%0e @0 Z Ѝ@`Ѝ$0S  Ѝ@`Ѝ0 t?op2$0 Ѝ@`Ѝ} "Hp  @@@0AmP@``p M(i9DQ;,X,,+w0%0 Ѝ@`Ѝ0%0t @0  Ѝ@`Ѝ$0S   Ѝ@`ЍY0 "?op2$0 Ѝ@`Ѝ+ "Hp  @@@{0Q Q- M  @0  Ѝ" p  @@@0 0_Q@mP M@ (0 Q L @0  Ѝ@Ѝ"J @0 "Hp  @@@O0fAm0` Xb M`@pMZ@_#sK0 pOT Ѝ@`ЍAmP`@0  M89T Ѝ@`ЍMXbZ@_`@cpsK0 pOjTAAm@P``$M Q񟗲/1D11$2$22/0/000 b?op280p00Sg :1P4p@`orV00SY2 0@0S 0,FP1 0,{T?V0@@WP\o`@ b`@82p"9p0@ @d|B P@@@^WX"0 @`$Ѝ@`ЁЍ80S2  $Ѝ@`ЁЍ+09000S80S 90S12 0@0Se 0,P 0,P@r090$Ѝ@`ЁЍ$Ѝ@`ЁЍX"Hp  @@@0XX @0 _pV!2\/X0@ @T@8P"p9@ @@d|2p@@XU0@ T@ v\@@0p@@-@,P @ 0,008 9@ЍQ Q- M X @0  ЍX" p  @@@0 0 Q- M  1  X@0 P ЍX"Hp  @@@0@-@M Q!44545454545455 5 5 5 5 54XB @0 Ѝ@ЍЍ@ЍX"Hp  @@@S0Bm]`z4PM` M8T @T  MPT,# @T@PP 0[Z000$Y 0 !12 0@`V1 P=-@(= M-00=Ѝ@`Ёء Ѝ0  0 P40@l#0 @E0@43l 0@E@ Am`m4`MMV. p@T) P PT 2 0@0S1 `P,< @ 0@@ =-00 B=-Ѝ@`ЁЍ|l#@ @X0|3l0@ X@C2Am@ 0@ `MRC P']4P=U  |c@@ p@`@ p0U@ = 00=Ѝ@`ЁЍ]=4P U 0 U0@0i0l# @Z]=4PU 0 U3l 0@@i -=4 RS @-@̠ @@@Ѝ͑=0/BmP@(`p`P5 @D5@$TYW qkP& @-@W+yv@`Ё Ѝl#p  @@@0l#p  @@@0AmJ =4`MPSP ,P @ -=0 0 p`  0+h=.0C R`#- ->0S>0>U   1R cЍ@`Ѝ Am@P`` M0+(p130$ P @0 5Ѝ@`ЍAm@` Pm`P VU 0P@` Ѝ0? 0@w1Am@`MP 000S 0CP 00 Ѝ@`ЍPP`0 R" @ R  P '`@ @l0 P `F``C60@@l`AmQ`p M`3:-\MPT ꜐(1T @T PzP @T'  @0  Ѝ@`ЁЍ.'p  @@@0@-0  0S S S 5@Ѝ+@ЍR@Ѝ$j@Ѝ2@-@ 0@ MR  P 0@'0 @ 1j/ @70@  Ѝ@Ѝ 70@@RAmP`M620` 0@ R]  P{O @@p0(!Pp!P Gp(!0p70@ ʌu0&`BV@@BY.$0@  @ R&  PI? 0@T5pP" 0 5Ѝ@`Ѝ80@@y8`0@@q@T(  MP <'p@ @1A 0@'0 @ 1w0@'0 @ B1<8`@0@ <@-@MT +!@0  Ѝ@Ѝ'Hp  @@@.1P /"AmP @0`MS% @ PЍ@`Ѝ @ 0`@S pprT0@'0 @1@ Q @ 0p@S ``YT8 p 0@`@@ Am0.<Α0` M\ ^ >QS00Ѝ@` Ѝ0S0 0'p  @@@0%2@ 0@PU 0,P 0,P'`8 0@' @J0`8 `0@@wAm@``MP&pP, 2 0@PU 0,DP 0,P`y8 0@' @J0' @0  Ѝ@`ЍgP2 0@, R\  PJ0,q p@@,00k Z0R 080 +PPW , @.P PUX 0,P 0,P`'p@ @0B T @0 ` '@ @0p >`90@@\`8 `0@@p@SPP0@ 0]k=`9 `0@@Q0S/:.>Q 0 QR '@-p  @@@100/0Q@-M S0@' @0  Ѝ@Ѝ'Hp  @@@0 @  Ѝ@Ѝ@m@ M PU P Ѝ@ Ѝ2 0@ R  P5 Ѝ@Ѝ 'P@ @e1 90@@e@-0S Q 00@Ѝ@Ѝ'p  @@@r10@-(M( "tP1S0(Ѝ@Ѝ2 0@@T P @'@ @v?:'$p  @@@1H9@0@ v?@-@ 0@#$0 0@b4 @@Ѝ*. P#0@W%P0`p Ѝ@`Ёء Ѝ2 0@ RG P$ 2 0@ R2 P 0@,0 @00( @<0@)K 0| ,@ @00 $ @D@0CD L< 0@@|< 0@@@-@B P #<0 B 0C0#<0@Ѝ30 @ :Am@` NgMV!0SK P<A Q 2 0@ R7 2P `0^8 < ,@ @`L 1Ѝ@` Ѝ7 # /r $ 03?(0+P @0 ,L,0@0Ѝ@` ЍU`< 0@@&  p  @@@00D @, ~2@-@ 0@ MR P 0@,0 @\0M? 0@ @D@Ѝ@Ѝ= @0@@\AmJ$``P @o-:]o P`00/@ Ѝ:/r ?S /AmZ?`MS@Ѝ@`Ѝԏ7p`0@ ?0o@p pk@P2 0@ )R _P ϕ0 p@\@, @b1\P ϕ0\=@ 0@@\bPXR 5P ϕ0 4@@,W?p @\Pϕ04=P@ 0@@W\P1 Bm @@ 0P``ᣑM 0pQ# w0S~ ^Xc ~0p s QsXYz sp#r0 sp3s0" @q 0wp00R 0^ P20 :xPNP ZP  P@ P@ξ 0-!3?80$Mp30LXЍ@`ЁЍ0@,0 @T0~0Y*2 0@ R P 0@,0 @L00= p0@@T 0{= 0@@L00AmL 0`Rp, @P!PP @0P0UnePPMXU\TP N޾T TPXP 0X00`L0@Ѝ,p  @@@1T/Am JP @PU P 0,@ @0f 000PT~ :N/%PEߍ@`ЁЍ,p  @@@1b, p  @@@>Zr=| 0. @2@PP pп000QP ?  ~⺿ 倒 @j  qɿl @ 0X@(@M P :l0@,0 @0 *0>  0@@ヿ`@뀒0 @T0 R- WP~ `0@,0 @z?˿p R. @PT0T0al>  0@@J`> @0@zALN0`@,0 @1P㘿N> `0@@P(Am@` M`00FXnPP  0T#P TTN PЍ@` Ѝ- M0 FXGP ЍR !\ A\ \ /RF R00SF /PF R R  R/R00 2AmP 0@@`p`MT9 P `Pဿ@@ 0@<@PnAm` M ` tPP0@rS sS0S0S pW  劾P1 0S$0xS Ѝ@`Ѝ0S0SpW  lP *P 00.  @s#!<$00!+Am@ @` PP PP@` ЍP 06/Am@5 ``P  K/(" Jx P6&0s0RS0P6@` ЍAm@5 ``6P (ҽ J ̽6&0s0TS0P6@` Ѝ*@-6S rQ S ¼@ЍRQ S RQ S R#R5 (▽ ⏽ ∽ $⁽Bm@ʌ_`MU6 \3 ^0Q0`0S} pb 0 ᏼ0:?SEY* )0P0\p@@@ |Ѝ@`ЁЍS}p0 S/0xSYO<>DP/ @㓡1c0S< 0 00L0:?S* 0 $P(0S,0S0S "1RQ 0 H00! 0 0  l/p  @@@0Hl/xp  @@@0@-P$M00  B =$ЍBm` iMP `O@@㹰 [a Pp5 `0 ^Y:`0P[L 00M00N0 PP⢾빰l2hmsgb_l2len(msg) <= sizeof(l1p->u.phDataReq.msgUnitParam.u8Buffer)%s %s PH-DATA.req(%s) %s %s MQ_L1_WRITE queue full. Dropping msg. fl1h->phy_inst%s Rx PH-RTS.ind SAPI=%s %s MQ_L1_WRITE queue full. Dropping msg. %s PH-DATA-INDICATION for unknown sapi %s (%d) %s Rx PH-DATA.ind %s (hL2 %08x): %s, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s Rx PH-RA.ind, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s PH-RACH-INDICATION has %d bits msgb(%p): No room for primitive msgb(%p): No room for primitive data sys_primunknown MPH-INFO.req %d unknown prim %d op %d Rx L1 prim %s on queue %d l1_if.c:82Rx SYS prim %s Tx RF-MUTE.req (%d, %d, %d, %d, %d, %d, %d, %d) Ignoring Clock Calibration for selected %s clock Using external attenuator. %u.%u dsp %u.%u.%u fpga %u.%u.%uBTS band %s not supported by hw Operating without calibration; unable to load tables! Tx SET-TRACE-FLAGS.req (0x%08x) MQ_SYS_WRITE queue full. Dropping msg Rx L1-RESET.conf (status=%s) L1-RESET.conf with status %s L1-RESET failuresysmoBTSv2 L1IF compiled against API headers v%u.%u.%u struct femtol1_hdlFailed to read from EEPROM. Read clock calibration(%d) from EEPROM. Unable to read band support from EEPROM, assuming all bands Clock source defaulting to GPS 1PPS on sysmoBTS 2050 l1_if.c:1742l1_if.c:1749RfClockInfo iClkCor=%d/clkSrc=%s Err=%d/ErrRes=%d/clkSrc=%s Calibrating GPS against GPS doesn not make sense. No reference clock set. Please reset first. Couldn't determine the clock difference. Cannot open L1 interface Unknown/Unsupported sysmoBTS Model Number %u Assuming 1002 for sysmoBTS Model number %u Cannot determine nominal transmit power. Assuming 23dBm. lchan2lch_par|ԟTt         oml.c:1115%s : %s tch_mode=0x%02x oml.c%s Channel mode %s is not supported! %s MPH-CONFIG.conf (%s) setTxPower %f dBm Rx RF-MUTE.conf status=%s RF-MUTE failureACTIVE ACT_PENDING DEACT_PENDING cnf->u8Tn < TRX_NR_TS%s %s Rx mphConnectCnf flags=%s%s%s DSP L1 is no longer sending primitives! %s Rx mphDisconnectCnf BSIC=0x%08xBS_AG_BLKS_RES=%u MS Power Level 0x%02xamrCmiPhase=0x%02x amrInitCodec=0x%02x (%x %s Requested TS connect as %s, expected a specific pchan instead %s pchan=%s ts_connect_as(%s) logChComb=%s Close TRX %u %s cannot determine L1 SAPI oml.c:1064%s MPH-ACTIVATE.req (hL2=0x%08x, %s %s SET_CIPHERING (ALG=%u %s) oml.c:1356%s MPH-CONFIG.req (%s) cfgParams Tn=%u, subCh=%u, dir=0x%x oml.c:738oml.c:746%s all SAPIs already released? %s MPH-DEACTIVATE.req (%s Unimplemented command type %d oml.c:757struct sapi_cmd%s act failed mark broken due status: %d Queue is now empty. More pending.oml.c:785%s End of SAPI cmd queue encountered.%s Failed to find lchan for hLayer3=0x%x %s MPH-ACTIVATE.conf (%s Successful activation of L1 SAPI %s on TS %u Error activating L1 SAPI %s on TS %u: %s %s Got activation confirmation with empty queue %s Confirmation mismatch (%d, %d) (%d, %d) RX_REQ -> RX_CONF RX_CONF_TX_REQ -> RXTX_CONF RXTX_REQ -> RX_CONF_TX_REQ unhandled state %u %s Got ciphering conf with empty queue %s MPH-DEACTIVATE.conf (%s Successful deactivation of L1 SAPI %s on TS %u Error deactivating L1 SAPI %s on TS %u: %s %s Got de-activation confirmation with empty queue %s Trying to activate lchan, but commands in queue %s is now broken. Stopping the release. Rx %s, status: %s ====> trying to activate lchans of BCCH Rx MPH-INIT.conf (status=%s) Rx MPH-INIT.conf status=%s MPH-INIT failureUnsupported GSM band %s Init TRX (ARFCN %u, TSC %u, RxPower % 2f dBm, TxPower % 2.2f dBm Discarding adm change command: pending procedure on RC %d %s modifying channel for handover %s already in release request state. %s TS disconnect Set NB TSCSet Tx power levelSet logical channel paramsConfigure ciphering paramssysmobts_vty.c:143 %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-thresh lower %u upper %u'.%sactivatePHY Clock Source: %s%sCannot find PHY link %u%sCannot find PHY instance %u%sDSP Version: %u.%u.%u, FPGA Version: %u.%u.%u%sGSM Band Support: enableddisabledFemto L1 DSP trace flags:%sDSP Trace %-15s %s%s nominal-tx-power %d%s dsp-trace-flag %s%s clock-calibration eeprom%s clock-calibration %d%s trx-calibration-path %s%s clock-source %s%s|trx <0-0> dsp-trace-flag (Transceiver related commands TRX number DSP Trace Flag no trx <0-0> dsp-trace-flag (Negate a command or set its defaults Transceiver related commands TRX number DSP Trace Flag dsp-trace-flag (no dsp-trace-flag (Negate a command or set its defaults DSP Trace Flag no trx <0-0> <0-7> loopback <0-1>Negate a command or set its defaults Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> <0-7> loopback <0-1>Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> rf-clock-info correctTransceiver related commands TRX number RF Clock Information Apply trx <0-0> rf-clock-info resetTransceiver related commands TRX number RF Clock Information Reset the counter trx <0-0> tx-power <-110-100>Transceiver related commands TRX number Set transmit power (override BSC) Transmit power in dBm trx <0-0> <0-7> (activate|deactivate) <0-7>Transceiver related commands TRX number Timeslot number Activate Logical Channel Deactivate Logical Channel Logical Channel Number show phy <0-255> instance <0-255> system-informationShow running system information Transceiver related commands TRX number Display information about system HIDDENNegate a command or set its defaults Transceiver related commands TRX number Transceiver related commands TRX number show dsp-trace-flags trx <0-0>Show running system information Transceiver related commands TRX number Display the current setting of the DSP trace flagsshow phy <0-255> clock-sourceShow running system information Transceiver related commands TRX number Display the clock source for this TRXnominal-tx-power <0-100>Set the nominal transmit output power in dBm Nominal transmit output power level in dBm uplink-power-target <-110-0>Obsolete alias for bts uplink-power-target Target uplink Rx level in dBm trx-calibration-path PATHSet the path name to TRX calibration data Path name clock-source (tcxo|ocxo|ext|gps)Set the clock source value Use the TCXO Use the OCXO Use an external clock Use the GPS pps clock-calibration <-4095-4095>Set the clock calibration value Offset in PPB clock-calibration defaultSet the clock calibration value Default Clock DAC value clock-calibration eepromUse the eeprom clock calibration value       %s RTP IN: %s tch.cRTP HR frame length %u != expected %u Unhandled DTX DL AMR FSM state %d %s unable to parse RTP payload %s RTP->L1: %s %s %s chan_nr %d Rx Payload size 0 L1P-to-RTP%s %s DTX: received ONSET from L1 (%d bytes) %s %s DTX: received SID_FIRST_P1 from L1 (%d bytes) %s %s DTX: received SID_FIRST_P2 from L1 (%d bytes) %s %s DTX: received SID_FIRST_INH from L1 (%d bytes) %s %s DTX: received SID_UPDATE_INH from L1 (%d bytes) %s %s %s Rx Payload Type %s is unsupported L1 HR frame length %u != expected %u %s %s Unhandled payload type %s, generating empty RTP tick %s %s %s Rx Payload Type %s incompatible with lchan %s %s chan_nr %d Rx FACCH /sys/class/leds/%s/brightnessactivity_ledonline_led<PdxȻܻ|v+ @Error reading RxCalibration from EEPROM, band=%d, ul=%d, err=%d calib_file.cError reading TxCalibration from EEPROM, band=%d, err=%d Reading an int from calib data failed. %f Reading a float from calib data failed. %s/%sFailed to open '%s' for calibration data. %s: u8IqImbalMode=%d FIXUPNO FIXUPUnable to read Ethenet MAC from EEPROM No calibration table fix-up needed, firmware < 3.3 MAC Address is %02x:%02x:%02x:%02x:%02x:%02x -> %s fileeepromL1 calibration table %s loaded (src: %s) L1 calibration table loading complete! No band_support?!? calib_rxu_850.cfgcalib_rxu_900.cfgcalib_rxu_1800.cfgcalib_rxu_1900.cfgcalib_rxd_850.cfgcalib_rxd_900.cfgcalib_rxd_1800.cfgcalib_rxd_1900.cfgcalib_tx_850.cfgcalib_tx_900.cfgcalib_tx_1800.cfgcalib_tx_1900.cfgr+/sys/bus/i2c/devices/i2c-1/1-0050/eepromeeprom fopeneeprom fseekeeprom fread %.4x| %.2x ;123456789:<=>@ABCDEFGHIJKLMNOPQRSUVWXYZ[\]^_`LT`p|  /sys/devices/platform/i2c_davinci.1/i2c-1/1-0050/eepromComputed CRC(%d) wanted CRC(%d) sysmoBTS 1002sysmoBTS 1002+GPS+PoEsysmoBTS 2050 (master)sysmoBTS 2050 (slave)sysmoBTS 2050 (unknown)Unknownethaddrclk-factorytemp-dig-maxtemp-rf-maxserial-nrhours-runningboot-countkeymodel-nrmodel-flagstrx-nrError setting new correction value.successsysmobts_ctrl.c%d,%s,%d,%d,%sclock-correctionclock-infoprim_size_for_queueread_dispatch_one4Pmsgb->l1herror writing to L1 msg_queue: %s l1_transp_hw.cshort write to L1 msg_queue: %u < %u writing on a wrong queue: %d false1l_fdfailed to read from fd: %s [%d] unable to open %s for reading: %s [%d] unable to open %s for writing: %s /dev/msgq/superfemto_arm2dsp/dev/msgq/gsml1_sig_arm2dsp/dev/msgq/gsml1_tch_arm2dsp/dev/msgq/gsml1_pdtch_arm2dsp/dev/msgq/superfemto_dsp2arm/dev/msgq/gsml1_sig_dsp2arm/dev/msgq/gsml1_tch_dsp2arm/dev/msgq/gsml1_pdtch_dsp2arml  0 <8p  L  ,shadow(bts=%u,trx=%u,ts=%u%s)PDCH(bts=%u,trx=%u,ts=%u%s,pchan=%s as %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s switching %s -> %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s)Physical Channel not configuredFCCH + SCH + BCCH + CCCH (Comb. IV)FCCH + SCH + BCCH + CCCH + 4 SDCCH + 2 SACCH (Comb. V)TCH/F + FACCH/F + SACCH (Comb. I)2 TCH/H + 2 FACCH/H + 2 SACCH (Comb. II)8 SDCCH + 4 SACCH (Comb. VII)Packet Data Channel for GPRS/EDGEDynamic TCH/F or GPRS PDCHUnknown / Unsupported channel combinationFCCH + SCH + BCCH + CCCH + CBCH + 3 SDCCH + 2 SACCH (Comb. V)7 SDCCH + 4 SACCH + CBCH (Comb. VII)Dynamic TCH/F or TCH/H or SDCCH/8 or GPRS PDCHNONECCCHCCCH+SDCCH4SDCCH8TCH/F_PDCHUNKNOWNCCCH+SDCCH4+CBCHSDCCH8+CBCHTCH/F_TCH/H_SDCCH8_PDCHBTS process timersabisAbis (RSL) related timerssysinfo.c%s: Unable to determine actual BS_AG_BLKS_RES value as SI3 is not available yet, fallback to 1 %s: Unable to determine actual NCH Position value as SI1 is not available yet. Disabling GPRS Indicator in SI (No PCU connected) Enabling GPRS Indicator in SI (PCU connected) Cannot parse SI4, hence not patching GPRS indicator $WOMLOC=%s INST=(%02x,%02x,%02x)msgb(%p): Not enough headroom msgb_push (allocated %u, head at %u < want headroom %u, len %u, tailroom %u) msgb->l3h%s: Sending FOM failed (no related BTS object found) %s: Tx %s %s: Sending %s to BSC: %s AVAIL STATE %s -> %s %s OPER STATE %s -> %s %s ADMIN STATE %s -> %s msgb(%p): msgb too small to pull %u (len %u) %s: Sending FOM NACK with cause %s %s: Sending FOM ACK %s: Failed to send ACK/NACK %s: Rx SET BTS ATTR New value for Attribute not supportedGiven ARFCN %u is not supported%s: Given ARFCN %u is not supported NM_ATT_START_TIME Attribute not supportedoml_bts_attroml.c:940oml.c:945%s: WARNING: Radio Link Timeout explicitly disabled, only use this for lab testing! %s: Given Conn. Failure Criterion not supported. Please use criterion 0x01 with RADIO_LINK_TIMEOUT value of 4..64 %s: Ignoring T200 BTS attribute. %s: T3105 must have a value != 0 %s: SET BTS ATTR: this BTS model does not support TSC %u != BSIC-BCC %u (TSC %u) %s: Rx SET RADIO CARRIER ATTR New value for Set Radio Attribute not supportedoml_trx_attroml.c:1138oml.c:1143%s: Set RF Max Power Reduction to %d dBm %s: Expecting only one ARFCN, because hopping not supported Given ARFCN %u is unsupported%s: Given ARFCN %u is unsupported OML-ack_nackUnknown/unhandled PCHAN type: %u %s %s: Rx SET CHAN ATTR New value for Set Channel Attribute not supported%s: SET CHAN ATTR: Frequency hopping not supported %s: SET CHAN ATTR: HSN and/or MAIO is missing: hsn=%u, maio=%u %s: SET CHAN ATTR: ARFCN list is missing %s: SET CHAN ATTR: ARFCN list is too long %s: SET CHAN ATTR: ARFCN list has odd length %s: SET CHAN ATTR: Starting time not supported oml_chan_attr%s: SET CHAN ATTR: invalid attribute value, rc=%d oml.c:1363oml.c:1369%s: SET CHAN ATTR: invalid Chan Comb 0x%x (pchan=%s, handle_chan_comb() returns %d) oml.c:1379%s: SET CHAN ATTR: this BTS model does not support TSC %u != BSIC-BCC %u oml.c:1397%s: SET CHAN ATTR (TSC=%d pchan=%s hsn=%u maio=%u chan_num=%uInitializing OML attribute definitions %s: Rx GET ATTR %s: Get Attributes for unknown Object Instance Get Attribute parsing failureGet Attribute without Attribute Listosmobtsmsgb(%p): msgb too small to get %u (len %u) %s: O&M Get Attributes [%u], %s is unsupported %s: Responding to O&M Get Attributes message with NACK 0%x %s: Rx CHG ADM STATE %s: Rx CHG ADM STATE: error during TLV parse %s: Rx CHG ADM STATE: no ADM state attribute %s: ADM state already was %s %s: ADM STATE %s -> %s %s: Rx IPA SET ATTR New value for IPAC Set Attribute not supported oml_ipa_attroml.c:1849Manufacturer O&M message too short Manufacturer OML message != ipaccess not supported msgb(%p): Negative length is not allowed Unexpected BTS %d in manufacturer O&M %s (exp. 0 or 0xFF)%s: TLV parse error %d %s: Rx IPACCESS(0x%02x): %s Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x for unknown TRX_NR=%u %s: Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x unknown Manufacturer O&M msg_type 0x%02xOML message too short Unsupported segmented O&M message Short OML message: %u < %u Formatted O&M message too short%s: GET ATTR with off-by-3 length: Fixing up for OS#3799 %s: OML message with %u extraneous bytes at end: %s Unexpected BTS %d in formatted O&M %s (exp. 0 or 0xFF)%s: Rx OPSTART %s: ... automatic ACK, OP state already was Enabled mo->fiunknown Formatted O&M msg_type 0x%02xunknown O&M msg_disc 0x%02x   27)L4m:Vs$4DX     8<d 4Hh| @Pt,P\|$0L\4t0@hxUpdated AGCH max queue length to %d bts.cstruct gsm_btsbts%dgprs_cell%d-0bts.c:292bts->features != NULL/tmp/pcu_btsbts->smscb_basic.ctrsbts->smscb_extended.ctrsrc == 0Main link established, sending NM Status AGCH: too many messages in queue, refusing message type %s, length = %d/%d Unhandled RSL channel type=0x%02x/rate=0x%02x %s BCCH carrier power reduction is not supported by this BTS model %s BCCH carrier power reduction value (%u dB) is incorrect or out of range %s BCCH carrier power reduction: %u dB (%s) DSP/HW based MS Power Control LoopMeasurement and Payload data combinedOML RadioChannel MO depends on RadioCarrier MOUplink interference measurementsBTS_TYPE_VARIANTBTS_SUB_MODELTRX_PHY_VERSIONunknownosmo-bts-lc15osmo-bts-oc2gosmo-bts-octphyosmo-bts-sysmoosmo-bts-trxosmo-bts-virtualosmo-bts-omldummyTime to wait between Channel Activation and dispatching a cached early Immediate AssignmentTime after which osmo-bts exits if regular ramp down during shut down process does not finish (s)Time after which osmo-bts exits if requesting transceivers to stop during shut down process does not finish (s)cbchcell broadcast channelcbch:rcvd_queuedReceived + queued CBCH messages (Abis)cbch:rcvd_droppedReceived + dropped CBCH messages (Abis)cbch:sent_singleSent single CBCH messages (Um)cbch:sent_defaultSent default CBCH messages (Um)cbch:sent_nullSent NULL CBCH messages (Um)base transceiver stationpaging:rcvdReceived paging requests (Abis)paging:dropDropped paging requests (Abis)paging:drop-psDropped paging requests (PS/PCU)paging:sentSent paging requests (Um)paging:congPaging congestion detected (Abis)rach:rcvdReceived RACH requests (Um)rach:dropDropped RACH requests (Um)rach:handoverReceived RACH requests (Handover)rach:vgcsReceived RACH requests (VGCS)rach:csReceived RACH requests (CS/Abis)rach:psReceived RACH requests (PS/PCU)agch:rcvdReceived AGCH requests (Abis)agch:sentSent AGCH requests (Abis)agch:deleteSent AGCH DELETE IND (Abis)rtp:rx:totalTotal number of received RTP packetsrtp:rx:markerNumber of received RTP packets with marker bit setrtp:rx:drop:preenTotal number of received RTP packets dropped during preeningrtp:rx:drop:loopbackTotal number of received RTP packets dropped during loopbackrtp:rx:drop:overflowTotal number of received RTP packets dropped during DL queue overflowrtp:rx:drop:v110_decTotal number of received RTP packets dropped during V.110 decodertp:tx:totalTotal number of transmitted RTP packetsrtp:tx:markerNumber of transmitted RTP packets with marker bit set bts_sm.c:44struct gsm_bts_smbts_smgprs_nse0gprs_nsvc%d-%dstruct gsm_bts_trx_tsbts_trx.cts != NULLtrx->ts[tn].mo.fi != NULLbts_trx.c:137bts_trx.c:140struct gsm_bts_trxbts%d-trx%d%s-ts%u(trx=NULL)(bts=%d,trx=%d)%u/%u/%u%s RSL link up Failed to establish RSL link (%d) GHrsl_rx_paging_cmdrsl_rx_sms_bcast_cmdrsl_rx_notification_cmdrsl_rx_osmo_etws_cmdrsl_rx_bs_pwr_ctrlrsl_rx_encr_cmdrsl_rx_ms_pwr_ctrlrsl_rx_meas_preproc_dftrsl_rx_bcch_inforsl_rx_ipac_dlcxrsl_rx_mode_modifrsl_rx_sacch_fillrsl_rx_sacch_inf_modrsl_rx_ipac_XXcxrsl_rx_imm_assrsl_rx_chan_activ%s Channel Mode IE is not present rsl.c%s Training Sequence IE is not present %s Channel Mode IE contains unknown 'Channel rate and type' value 0x%02x %s Channel Mode IE contains an unknown/unhandled combination of 'Speech or data indicator' 0x%02x and 'Speech coding algorithm/data rate' 0x%02x %s Channel type=0x%02x/mode=%s is not supported by the PHY %s BTS doesn't support cipher %s %s Encryption Info cannot have len=%d %s Setting lchan cipher algorithm %s %sunknown chan_nr=0x%02x %s %smismatching chan_nr=0x%02x %s This PHY does not support lchan TSC %u != BSIC-TSC %u, sending NACK %s Missing MultiRate conf IE (TCH mode is %s) %s Unexpected MultiRate conf IE (TCH mode is %s) %s Error parsing MultiRate conf IE RSLACTDEACT%s Tx PDCH %s NACK (cause = 0x%02x) %s (ss=%d) %s Tx CHAN ACT ACK 0x%02x: Tx MODE MODIFY NACK (cause = 0x%02x) Sending Channel Activated NACK: cause = 0x%02x Tx RSL Error Report: cause = 0x%02x size >= headroomRSL Radio Link Layer message too short Rx RLL %s for unknown lchan %s Rx RLL %s for lchan which isn't active %s Rx RLL %s Abis -> LAPDm RSL rx RLL: %s %s(): rsl_tlv_parse() failed BTS paging table is full%s %s(): chan nr is not Downlink CCCH FACCH copyETWS Primary Notification OFF rsl.c:981ETWS Primary Notification: %s rsl.c:991rsl.c:993%s Fast Power Control is not supported %s Failed to parse BS Power Parameters IE %s BS POWER CONTROL: attenuation change %u -> %u dB %s Fwd RSL ENCR CMD (Alg %u) to LAPDm %s Rx MS POWER CONTROL %u %s Failed to parse MS Power Parameters IE %s Unable to calculate power levels to dBm: %u -> %d, %u -> %d %s Rx Measurement Pre-processing Defaults rsl.c:1348rsl.c:1353rsl.c:1366rsl.c:1371struct gsm_power_ctrl_params Rx RSL SI 0x%02x not supported. Truncating received Full BCCH Info (%u -> %zu) for SI%s Rx RSL BCCH INFO (SI%s, %u bytes) Rx RSL SI2quater count updated: %u -> %d Rx RSL SI2quater with index %u > count %u Rx RSL SI2quater with impossible parameters: index %u, count %ushould be <= %u BCCH INFO Rx RSL BCCH INFO (SI%s) RX RSL Disabling BCCH INFO (SI%s) %s RSL Tx %s %s RSL Tx IPAC_DLCX_NACK %s RSL Tx IPAC_DLCX_ACK DLCX%s Tx MODE MODIF ACK Rx SACCH SI 0x%02x not supported. Truncating received SI%s (%u -> %zu) to prepend LAPDM UI header (2 bytes) Rx RSL SACCH FILLING (SI%s, %u bytes) Rx RSL Disabling SACCH FILLING (SI%s) %s Starting time not supported %s Rx SACCH SI 0x%02x not supported. %s Rx RSL SACCH FILLING (SI%s) %s Rx RSL Disabling SACCH FILLING (SI%s) CRCXMDCX0.0.0.0%s IPAC_%s: connect_ip=%s connect_port=%u speech_mode=%u payload_type=%u payload_type2=%u osmux_cid=%u rtp_extensions=%u %s Rx RSL IPAC %s, RTP_PT and RTP_PT2 in same msg !?! csd_fmt_d=%d csd_fmt_ir=%d %s Rx RSL IPAC %s, csd_fmt_d=%d is not supported %s Rx RSL IPAC XXcx without Osmux CIDgoes against configured Osmux policy 'only' %s Rx RSL IPAC MDCX, but we have no RTP socket! %s Rx RSL IPAC XXcx with Osmux CIDgoes against configured Osmux policy 'off' %s Rx RSL IPAC MDCX with Osmux CID, CRCX was configured as RTP! %s RSL Tx IPAC_%s_ACK (local %s:%u, remote %s:%u) Tx RSL RF RESource INDication Early IA check: %s (ss=%d) PDCH release: not in PDCH mode %s PCU rel ack for unexpected lchan kind %s %s not sending REL ACK %s (ss=%d) %s Tx CHAN REL ACK %s Sending HANDOver DETect %s Sending LISTENER DETect %s Sending TALKER DETect %s not sending CHAN ACT %s %s missing Activation Type %s error: lchan is not available, but in state: %s. %s error: reactivation on inactive lchan. %s rx chan activ but TS not in nm_state oper=ENABLED avail=OK, nack! chan nr 0x%x not covered by dyn_pchan_from_chan_nr() %s rx chan activ %s dyn_ts_l1_reconnect %s Cannot reconnect as pchan %s %s Disconnect lchan->pending_chan_activ == NULL%s Missing Handover Reference IE %s BS Power attenuation %u dB %s Error parsing SACCH INFO IE %s chan_nr=%s type=0x%02x=%s mode=%s %s Cannot send act ack: %d %s Activate via PCU %s Activate via PCU when PCU connects %s Sending Connection Failure: cause = 0x%02x Sending Channel Required %s Sending RTP delete indication: cause = %s %s Internal Error: both PDCH ACT and PDCH DEACT pending PDCH %s on dynamic TCH/F_PDCH returned error %d %s %s switched to %s mode (ts->flags == %x) %s Tx PDCH %s ACK Failed to transmit PDCH %s ACK, rc %d %s PDCH DEACT operation: channel disconnected, will reconnect as TCH %s PDCH ACT operation: channel disconnected, will reconnect as PDTCH %s Disconnected %s Dyn TS disconnected, but invalid desired pchan: %s %s Connect %s PDCH ACT IPA operation failed (%d) in bts model %s PDCH DEACT error: timeslot connected, so expecting lchan type TCH/F, but is %s %s PDCH DEACT operation: timeslot connected as TCH/F %s PDCH ACT error: timeslot connected, so expecting lchan type PDTCH, but is %s %s PDCH ACT operation: timeslot connected as PDTCH %s PDCH ACT OSMO operation failed (%d) in bts model %s Connected %s chan_num:%u Tx MEAS RES valid(%d), flags(%02x) %s Send Meas RES: NUM:%u, RXLEV_FULL:%u, RXLEV_SUB:%u, RXQUAL_FULL:%u, RXQUAL_SUB:%u, MS_PWR:%u, UL_TA:%u, L3_LEN:%u, TimingOff:%u []msg%s (%s) is not active. Dropping message (len=%u): %s %s RLL EST IND without contention resolution. %s Short GPRS SUSPEND REQ received, ignoring %s Fwd GPRS SUSPEND REQ for TLLI=0x%08x to PCU %s Fwd RLL msg %s from LAPDm to A-bis %s Scheduling %s to L3 in next associated TCH-RTS.ind %s Dropping pending release indication message ACT DEACTRSL message too short RSL Common Channel Management message too short RSL rx CCHAN: Rx RSL %s for unknown lchan %s Rx RSL %s %s unimplemented RSL cchan msg_type %s %s undefined RSL cchan msg_type 0x%02x RSL Dedicated Channel Management message too short %s ss=%d Rx RSL %s %s ss=%d state=%s Rx RSL RF Channel Release, but is already inactive; just ACKing the release %s Request to PDCH %s, but PDCH%s%s is still pending %s Request to PDCH %s, but lchan is still in state %s %s Attempt to PDCH %s on TS that is not a TCH/F_PDCH (is %s) %s Request to PDCH %s, but is already so %s unimplemented RSL dchan msg_type %s %s undefined RSL dchan msg_type 0x%02x undefined RSL TRX msg_type 0x%02x RSL ip.access message too short %s unsupported RSL ip.access msg_type 0x%02x unknown RSL msg_discr 0x%02x RSL rx DCHAN: RSL rx IPACC: struct rtp_abst_socketrtp_abstract.c:58rtp_abstract.c:69rtp_abstract.c:83Closing RTP socket on %s RTP session complete with %s rtp_abstract.cRx active for %u ticks twjit rx_packets=%u delivered_pkt=%u twjit handovers_in=%u handovers_out=%u twjit too_old=%u twjit underruns=%u twjit ho_underruns=%u twjit soft_underruns=%u twjit output_gaps=%u twjit thinning_drops=%u twjit duplicate_ts=%u twjit ssrc_changes=%u twjit seq_skips=%u twjit seq_backwards=%u twjit seq_repeats=%u twjit intentional_gaps=%u twjit ts_resets=%u Rx max jitter %u.%03u ms Rx %u RTP packets from wrong src Rx %u RTCP packets from wrong src Rx %u bad RTP packets (twjit) Rx %u bad RTP packets (after twjit) Rx wrong pt number (%u times) Rx failed to extract payload (%u times) Rx %u bad RTCP packets Rx RTCP RR for wrong SSRC (%u times) Tx %u RTP packets x   Ȏ (pCopyright (C) 2010-2011 by Harald Welte, Andreas Eversberg and On-Waves Copyright (C) 2011-2022 by sysmocom - s.f.m.c. GmbH License AGPLv3+: GNU AGPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'no rxlev-avg'.%s%% rtp bind-ip is now deprecated%s%*sLower threshold (L_%s_XX_P): %u%s%*sUpper threshold (U_%s_XX_P): %u%s%*sLower threshold comparators: P%u=%02u / N%u=%02u%s%*sUpper threshold comparators: P%u=%02u / N%u=%02u%s%*sPre-processing algorithm: unweighted average%sweighted average%smodified median%sEWMA (alpha=%u)%sdisabled (pass-through)%sunknown%s%*sPre-processing parameters: Hreqave=%u / Hreqt=%u%s%*sPower control interval: %u ms (every %u SACCH block(s))%s%*sPower increase step size: %u%s%*sPower reduce step size: %u%s%*sRxLev measurement processing:%sRXLEV%*sRxQual measurement processing:%sRXQUAL%*sC/I measurement processing (FR/EFR):%sCI_FR%*sC/I measurement processing (HR):%sCI_HR%*sC/I measurement processing (AMR-FR):%sCI_AMR_FR%*sC/I measurement processing (AMR-HR):%sCI_AMR_HR%*sC/I measurement processing (SDCCH):%sCI_SDCCH%*sC/I measurement processing (GPRS):%sCI_GPRS%% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-avg algo osmo-ewma beta %s'.%s%% Range end port (%u) must be greater than the range start port (%u)!%s%% Range must begin at an even port number! (%u is odd)%s%% Range must end at an odd port number! (%u is even)%s%% No such instance %u%s%% Unable to create phy%u instance %u%sphy %u%s%% Unknown BTS number %u (num %u)%s%% No such BTS (%d)%s%% Incorrect BCCH power reduction value, an even number is expected%s%% BCCH carrier power reduction operation mode is not supported for BTS (%d)%s%% can't find BTS '%s'%sinfinite%% INFINITE RADIO LINK TIMEOUT, USE ONLY FOR BTS RF TESTING%sonlyskip-nullrfc5993twrtptest message sent from VTY%% phy%s does not exist%s%% phy%s instance %s does not exit%s%% phy%s instance %s is already bound to %s%s%% The next unused TRX number is %u%s%% Unable to allocate TRX %u%svty.c:2420%% This command requires restart%svty.c:2403localhost/opt/poky-oc2g/2.3.4/sysroots/cortexa15hf-neon-poky-linux-gnueabi/usr/local/jenkins-build/inst-osmo-bts-oc2g/include/osmocom/core/utils.h:127%% duplicate BSC (A-Bis/OML) ip address configured ('%s')%sstruct bsc_oml_hostvty.cbsc_oml_hostbsc_oml_host->addrOper '%s', Admin '%s', Avail '%s'%s(null)fall-backfrom BSCconnecteddisconnectedTRX %u of BTS %u is on ARFCN %u%sDescription: %s%s RF Nominal Power: %d dBm, reduced by %u dB, resulting BS power: %d dBm%s BS Power control parameters (%s):%s MS Power control parameters (%s):%s NM State: RSL State: %s%s Baseband Transceiver NM State: IPA stream ID: 0x%02x%sBTS %u, TRX %u, Timeslot %u, phys cfg %s, TSC %u (%s mode)%% can't find TRX '%s'%s%% can't find TS '%s'%ssapi >= 0sapi <= 31vty.c:2784uint16_tosmo%% BTS model 'osmo-bts-trx' has no DSP/HW MS Power Control support, consider updating your configuration file!%s%% This BTS model has no DSP/HW MS Power Control support%s%% Could not resolve logical channel%s%% BAND '%s' is not a valid GSM band%svty.c:705%% no such BSC (A-Bis/OML) ip address configured ('%s')%s as %s switching %s -> %sshadowprimaryBTS %u, TRX %u, Timeslot %u (%s) %s, Lchan %u, Type %s, State %s - RXL-FULL-ul: %4d dBm%s%d SACCH blocksThemyscira twrtpBelledonne ortpRTP library: %s%s%% this channel has no active RTP stream%s%% error setting jitter parameters: %s%s%% jitter parameters set: %d%sbs-power-ctrldynamiccurrent Error reason: staticendisBTS %u, TRX %u, Timeslot %u (%s), Lchan %u: Type %s%s Osmocom Dyn TS: IPACC Dyn PDCH TS: State: %s%s%s%s Channel Mode / Codec: %s%s CSD mode: %s%s AMR Multi-Rate Configuration: ICMI=%u, Start Mode=%u gsm48=%02x%02x%s AMR Mode %u (%s), threshold=%u, hysteresis=%u%s Bound IP: %s Port %u CONN_ID=%u Osmux_CID=%u%s RTP_TYPE2=%u%s Conn. IP: %s Port %u SPEECH_MODE=0x%02x RTP_TYPE=%u%s LAPDm SAPIs: DCCH %c%c, SACCH %c%c%s Valid System Information: 0x%08x%s MS Timing Offset: %d, propagation delay: %d symbols %s Ciphering A5/%u State: %s, N(S)=%u%s RTP/PDCH Loopback Enabled%s Radio Link Failure Counter 'S': %d%s Interference: %d dBm (band %d)%s%*sBS (Downlink) Power Control (%s mode):%s%*sChannel reduction: %u dB (max %u dB)%*sTRX reduction: %u dB%s%*sActual / Nominal power: %d dBm / %d dBm%s%*sPower Control parameters:%s%*sMS (Uplink) Power Control (%s):%s%*sCurrent power level: %u, %d dBm (max %u, %d dBm)%*sACCH repetition:%s%*sEnable RXQUAL threshold: %u%s%*sEnable RXQUAL threshold: (none, alway on)%s%*sDL-FACCH:%s%*sretramsit all LAPDM block types%s%*sretramsit only LAPDM command blocks%s%*sno retransmission (disabled)%s%*sretransmission currently active%s%*sretransmission currently inactive%s%*sDL-SACCH:%s%*sretramsit all SACCH blocks for SAPI=0%s%*sUL-SACCH:%s%*sTemporary ACCH overpower:%s%*sOverpower value: %u dB%s%*sSACCH overpower: %sabled%s%*sFACCH overpower: %sabled%s%*sRxQual threshold: disabled (overpower is always on)%s%*sRxQual threshold: %u%sno ts101318offbts %u%s description %s%s band %s%s auto-band%s ipa unit-id %u %u%s rtp jitter-buffer %u oml remote-ip %s%s adaptive rtp port-range %u %u%s rtp ip-dscp %d%s rtp socket-priority %d%s rtp library twrtp%s rtp continuous-streaming%s %srtp internal-uplink-ecu%s rtp hr-format %s%s paging queue-size %u%s paging lifetime %u%suplink %s-power-target %d hysteresis %d %s-power-filtering algo ewma beta %u%s no %s-power-filtering%s agch-queue-mgmt threshold %d low %d high %d%s gsmtap-remote-host %s%s gsmtap-local-host %s%s gsmtap-sapi %s%s gsmtap-rlp skip-null%s gsmtap-rlp%s min-qual-rach %d%s min-qual-norm %d%s max-ber10k-rach %u%s pcu-socket %s%s pcu-socket-wqueue-length %u%s supp-meas-info toa256%s smscb queue-max-length %d%s smscb queue-target-length %d%s smscb queue-hysteresis %d%s%sosmux%s%s use on%sonly%soff%s%s local-ip %s%s%s local-port %u%s%s batch-factor %d%s%s batch-size %u%s%s dummy-padding %s%s twjit%s trx %u%s user-gain %u mdB%s power-ramp max-initial %d mdBm%s power-ramp step-size %d mdB%s power-ramp step-interval %d%s ms-power-control %s%s ta-control interval %u%s phy %u instance %u%s[BTS %u, RAC %u, NSEI %u, BVCI %u%s Cell NM state: NSE NM state: NSVC%u (NSVCI %u) NM state: Address: r=%s%s%s:%u<->l=%s%s%s:%u%s%% can't find BTS %s%s%% can't find TRX %s%s%% can't find TS %s%s%% can't find LCHAN %s%sBTS %u is of type '%s', in band %s, has CI %u LAC %u, BSIC %u and %u TRX%s Description: %s%s Unit ID: %u/%u/0, OML Stream ID 0x%02x%s Site Mgr NM State: PCU version %s connected%s Paging: Queue size %u, occupied %u, lifetime %us%s AGCH: Queue limit %u, occupied %d, dropped %llu, merged %llu, rejected %llu, ag-res %llu, non-res %llu%s CBCH queue target: %d, hysteresis: %d, maximum: %d%s CBCH backlog queue length (BASIC): %d%s CBCH backlog queue length (EXTENDED): %u%s Paging: queue length %d, buffer space %d%s OML Link state: %s.%s PH-RTS.ind FN advance average: %d, min: %d, max: %d%s Radio Link Timeout (OML): %s%s Radio Link Timeout (OVERRIDE): %s%s BCCH carrier power reduction: %u dB%s TRX %u%s phy %d %s (%s) Features:%s %03u %-40s%s (not available)%s BTS model specific (internal) flags:%s%% Cannot find PHY link number %d%s%% Cannot find PHY instance number %d%sgsmtap-sapi (Enable sending of UL/DL messages over GSMTAP no gsmtap-sapi (Negate a command or set its defaults Disable sending of UL/DL messages over GSMTAP logging filter l1-sapi (Configure logging Filter log messages L1 SAPI no logging filter l1-sapi (Negate a command or set its defaults Configure logging Filter log messages L1 SAPI bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) value (current|max) <0-255>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change current power value Current value (for both dynamic and static modes) Maximum value (for dynamic mode only) BS power reduction (in dB) or MS power level bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) mode (static|dynamic)BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change power control mode Disable the power control loop Enable the power control loop no bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackNegate a command or set its defaults BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackBTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> rtp jitter-buffer <0-10000>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number RTP settings Jitter buffer Size of jitter buffer in (ms) no instance <0-255>Negate a command or set its defaults Select a PHY instance to remove PHY Instance number Select a PHY instance to configure PHY Instance number phy <0-255>Select a PHY to configure PHY number %s(phy-inst)# %s(phy)# no gsmtap-rlpNegate a command or set its defaults Disable generation of GSMTAP frames for RLP (non-transparent CSD) gsmtap-rlp [skip-null]Enable generation of GSMTAP frames for RLP (non-transparent CSD) Skip the generation of GSMTAP for RLP NULL frames gsmtap-sapi (enable-all|disable-all)Enable/disable sending of UL/DL messages over GSMTAP Enable all kinds of messages (all SAPI) Disable all kinds of messages (all SAPI) no gsmtap-local-hostNegate a command or set its defaults Disable local bind for GSMTAP Um logging no gsmtap-remote-hostNegate a command or set its defaults Disable GSMTAP Um logging gsmtap-local-host HOSTNAMEEnable local bind for GSMTAP Um logging (see also 'gsmtap-sapi') Local IP address or hostname gsmtap-remote-host [HOSTNAME]Enable GSMTAP Um logging (see also 'gsmtap-sapi') Remote IP address or hostname ('localhost' if omitted) show lchan summary [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel Short summary BTS Number TRX Number Timeslot Number Logical Channel Number show lchan [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel BTS Number TRX Number Timeslot Number Logical Channel Number show timeslot [<0-255>] [<0-255>] [<0-7>]Show running system information Display information about a TS BTS Number TRX Number Timeslot Number show trx [<0-255>] [<0-255>]Show running system information Display information about a TRX BTS Number TRX Number bts <0-0> c0-power-red <0-6>BTS Specific Commands BTS Number BCCH carrier power reduction operation Power reduction value (in dB, even numbers only) bts <0-0> radio-link-timeout (oml|infinite|<4-64>)BTS Specific Commands BTS Number Manually override Radio Link Timeout Use value provided by BSC via A-bis OML (Connection Failure Criterion) Use infinite timeout (DANGEROUS: only use during testing!) Number of lost SACCH blocks test send-failure-event-report <0-255>Various testing commands Send a test OML failure event report to the BSC BTS Number show bts <0-255> rtpShow running system information Display information about a BTS BTS Number RTP library selection show bts <0-255> gprsShow running system information Display information about a BTS BTS Number GPRS/EGPRS configuration show bts [<0-255>]Show running system information Display information about a BTS BTS Number phy <0-255> instance <0-255>Configure PHY Link+Instance for this TRX PHY Link number PHY instance PHY Instance numberta-control interval <0-31>Timing Advance Control Parameters Set TA control loop interval As in P_CON_INTERVAL, in units of 2 SACCH periods (0.96 seconds) (default=0, every SACCH block) ms-power-control (dsp|osmo)Mobile Station Power Level Control Handled by DSP Handled by OsmoBTS power-ramp step-interval <1-100>Power-Ramp settings Power increase by step Step time in seconds power-ramp step-size <1-100000> (dB|mdB)Power-Ramp settings Power increase by step Step size Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) power-ramp max-initial <-10000-100000> (dBm|mdBm)Power-Ramp settings Maximum initial power Value Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) user-gain <-100000-100000> (dB|mdB)Inform BTS about additional, user-provided gain or attenuation at TRX output Value of user-provided external gain(+)/attenuation(-) Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) smscb queue-hysteresis <0-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Hysteresis of the SMSCB (CBCH) queue In count of messages/pages (default: 2) smscb queue-target-length <1-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Target length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 2) smscb queue-max-length <1-60>SMSCB (SMS Cell Broadcast) / CBCH configuration Maximum length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 15) no supp-meas-info toa256Negate a command or set its defaults Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods supp-meas-info toa256Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods pcu-socket-wqueue-length <1-2147483647>Configure the PCU socket queue length Queue length pcu-socket PATHConfigure the PCU socket file/path name UNIX socket path max-ber10k-rach <0-10000>Set the maximum BER for valid RACH requests BER in 1/10000 units (0=no BER; 100=1% BER) min-qual-norm <-100-100>Set the minimum link quality level of Normal Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) min-qual-rach <-100-100>Set the minimum link quality level of Access Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) uplink-power-filtering algo ewma beta <1-99>Configure filtering for uplink power control loop Select the filtering algorithm Exponentially Weighted Moving Average (EWMA) Smoothing factor (in %): beta = (100 - alpha) 1% - lowest smoothing, 99% - highest smoothing no uplink-power-filteringNegate a command or set its defaults Disable filtering for uplink power control loop uplink-power-target <-110-0> hysteresis <1-25>Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm Target Rx Level hysteresis Tolerable deviation in dBm Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm agch-queue-mgmt defaultAGCH queue mgmt Reset clean parameters to default values agch-queue-mgmt threshold <0-100> low <0-100> high <0-100000>AGCH queue mgmt Threshold to start cleanup in % of the maximum queue length Low water mark for cleanup in % of the maximum queue length High water mark for cleanup in % of the maximum queue length paging lifetime <0-60>Paging related parameters Maximum lifetime of a paging record Maximum lifetime of a paging record (secods) paging queue-size <1-1024>Paging related parameters Maximum length of BTS-internal paging queue Maximum length of BTS-internal paging queue (default 200) rtp hr-format (rfc5993|ts101318)RTP parameters HRv1 codec output format RFC 5993 TS 101 318 no rtp internal-uplink-ecuNegate a command or set its defaults RTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream rtp internal-uplink-ecuRTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream no rtp continuous-streamingNegate a command or set its defaults RTP parameters Always emit an RTP packet every 20 ms rtp continuous-streamingRTP parameters Always emit an RTP packet every 20 ms rtp library (ortp|twrtp)RTP parameters RTP library selection Belledonne ortp Themyscira twrtp rtp socket-priority <0-255>RTP parameters Specify socket priority for RTP/IP packets The socket priority value (> 6 requires CAP_NET_ADMIN) rtp ip-dscp <0-63>RTP parameters Specify DSCP for RTP/IP packets The DSCP value (upper 6 bits of TOS) rtp port-range <1-65534> <1-65534>RTP parameters Range of local ports to use for RTP/RTCP traffic Port range start (inclusive) Port range end (inclusive) rtp jitter-buffer <0-10000> [adaptive]RTP parameters RTP jitter buffer Jitter buffer in ms Enable adaptive RTP jitter buffering rtp bind-ip A.B.C.DRTP parameters RTP local bind IP Address RTP local bind IP Address no oml remote-ip A.B.C.DNegate a command or set its defaults OML Parameters OML IP Address OML IP Address oml remote-ip A.B.C.DOML Parameters OML IP Address OML IP Address band (450|GSM450|480|GSM480|750|GSM750|810|GSM810|850|GSM850|900|GSM900|1800|DCS1800|1900|PCS1900)Set the frequency band of this BTS Alias for GSM450 450Mhz Alias for GSM480 480Mhz Alias for GSM750 750Mhz Alias for GSM810 810Mhz Alias for GSM850 850Mhz Alias for GSM900 900Mhz Alias for DCS1800 1800Mhz Alias for PCS1900 1900Mhz ipa unit-id <0-65534> <0-255>ip.access RSL commands Set the Unit ID of this BTS Site ID Unit ID bts BTS_NRSelect a BTS to configure BTS Number vty telnet-port <0-65535>Configure the VTY Set the VTY telnet port TCP Port number trx <0-254>Select a TRX to configure TRX number twjitConfigure TW jitter bufferdummy-padding (on|off)Dummy padding Enable dummy padding Disable dummy padding (default) batch-size <1-65535>Batch size Batch size in bytes batch-factor <1-8>Batching factor Number of messages in the batch local-port <1-65535>Osmux port UDP port local-ip (A.B.C.D|X:X::X:X)IP information IPv4 Address to bind to IPv6 Address to bind to use (off|on|only)Configure Osmux usage Never use Osmux Use Osmux if requested by BSC (default) Always use Osmux, reject non-Osmux BSC requests osmuxConfigure Osmux no auto-bandNegate a command or set its defaults Automatically select band for ARFCN based on configured band auto-bandAutomatically select band for ARFCN based on configured band %s(twjit)# %s(osmux)# %s(trx)# %s(bts)# OsmoBTSThis command applies for newly created lchansThis command applies when the TRX powercycles or restartsBSC Send PAGING for group %u, but number of paging sub-channels is only %u paging.cDropping paging, queue full (%u) Ignoring duplicate paging struct paging_recordpaging.c:254Add paging to queue (group=%u, queue_len=%u) Dropping paging for PS, queue congested (%u) short IMSI (%zu digits), will assume "000" to calculate paging group Add MAC block to paging queue (group=%u) etws_len < 128/8Paging called for GSM wrong time: FN %d/%d/%d/%d. paging.c:738Tx PAGING TYPE 3 (4 TMSI) Tx PAGING TYPE 2 (2 TMSI,1 xMSI) Tx PAGING TYPE 1 (1 xMSI,1 empty) Tx PAGING TYPE 1 (2 xMSI) paging.c:823Removed paging record, queue_len=%u Paging SI update struct paging_statepaging.c:896num_paging != 0 after flushing all records?!? ZZ &&@@gg33MMZg &3@MBFJNbX\ %s %s Unsupported lchan->tch_mode %u measurement.c%s %s meas period end fn_mod:%d, status:%d, pchan:%s SUBFULL%s %s measurement during state: %s, num_ul_meas=%d, fn_mod=%u %s %s no space for uplink measurement, num_ul_meas=%d, fn_mod=%u %s %s adding a %s measurement (ber10k=%u, ta_offs=%d, ci_cB=%d, rssi=-%u), num_ul_meas=%d, fn_mod=%u %s Calculating measurement results for physical channel: %s %s Received %u UL measurements, expected %u %s Received %u excess UL measurements %s Replaced %u measurements with dummy values, from which %u were SUB measurements %s Received UL measurements contain %u SUB measurements, expected at least %d %s Incorrect number of SUB measurements detected! (%u vs exp >=%d) %s Received UL measurements contain %u SUB measurements, expected %d %s Incorrect number of SUB measurements detected! (%u vs exp %d) %s Computed TA256(% 4d), BER-FULL(%2u.%02u%%), RSSI-FULL(-%3udBm), C/I-FULL(% 4d cB), BER-SUB(%2u.%02u%%), RSSI-SUB(-%3udBm), C/I-SUB(% 4d cB) %s UL MEAS RXLEV_FULL(%u), RXLEV_SUB(%u), RXQUAL_FULL(%u), RXQUAL_SUB(%u), num_meas_sub(%u), num_ul_meas(%u) i < lchan->meas.num_ul_meassq_diff_sum <= UINT32_MAXinactive => activeactive => inactive%s Temporary ACCH overpower: %s %s DL-FACCH repetition: inactive => active %s DL-FACCH repetition: active => inactive % -%s AMR MR Conf: num_modes=%uamr.c, mode[%u] = %u/%u/%uAMR CMI %u not part of AMR MR set RTP->L1: overriding CMR %u AMR Multirate IE is too short (%u) AMR Multirate Version %u unknown AMR Multirate with %u modes len=%u not possible %s T3115 timeout (%d resends left) asci.c%s is not active. It is in state %s. Ignoring %s NY2 reached, sending CONNection FAILure to BSC. %s VGCS RACH on dedicated channel type %s received with TA=%u, ref=%u %s Ignoring RACH, there is an active talker already. %s Failed to deactivate uplink access after TALKER DET. %s Starting T3115 with %u ms %s Channel is activated. %s Failed to activate uplink access after channel activation. %s Channel is activated for assignment. %s Failed to deactivate uplink access for assignment. %s First valid frame detected, talker now active. %s Uplink released, no talker. %s Failed to activate uplink access after uplink became free. eeef$fdddde,eDe\ete eeeeeelchan.clchan_nr == 0lchan_nr < 2lchan_nr < 4lchan_nr < 8ts=%u,ss=%u Physical channel %s not expected! ts=%u,ss=%u Physical channel %s (0x%02x) not expected! (bts=%u,trx=%u,ts=%u%s,ss=%u)lchan.c:161%s Setting T200 D0=%u, D3=%u, S0=%u, S3=%u (all in frames) lchan%s SACCH no SI available %s state %s -> %s Channel Release%s: PDCH release requested but already in switchover %s Not enough room to store interference report (%ddBm) meas_num > 0%s Interference AVG: %ddBm (band %d, samples %u) %s Rx RSL IPAC CRCX, but we already have socket! %s IPAC Failed to create RTP/RTCP sockets %s IPAC Failed to create RTP/RTCP sockets%s IPAC Failed to set RTP socket parameters: %s %s IPAC set RTP socket parameters: %d failed to set DSCP=%d: %s failed to set socket priority %d: %s %s IPAC Failed to bind RTP/RTCP sockets %s IPAC Failed to bind RTP/RTCP socketsbts@%sOsmoBTS-1.11.0.7-0c5d%s Failed to connect RTP/RTCP sockets %s IPAC cannot obtain locally bound IP/port: %d %s freeing %d queued frames non-transparenttransparent @ 1200/75 bpstransparent @ 600 bpstransparent @ 1200 bpstransparent @ 2400 bpstransparent @ 4800 bpstransparent @ 9600 bpstransparent @ 14400 bpstransparent @ 29000 bpstransparent @ 32000 bpsRX_REQRX_CONFRXTX_REQRX_CONF_TX_REQRXTX_CONFACTIVATION REQUESTEDACTIVERELEASE REQUESTEDRELEASE DUE ERRORBROKEN UNUSABLEop %s not (yet) provisioned pcu_sock.cA transceiver with ARFCN %u is not (yet) provisioned PCU socket has LOST connection PCU socket has LOST connectionPCUIF connection closed pcu_sock.c:1193pcu_sock_txPCU socket not created, dropping message PCU socket not connected, dropping message Sending info BTS is up BTS is down %s PCU interface (version %u) cannot handle more than %zu transceivers => skipped %s unavailable for PCU (op=%s adm=%s) %s PDCH on ts=%u is available (tsc=%u hopping=yes hsn=%u maio=%u ma_bit_len=%u) hopping=no arfcn=%u) PCU connects but we already have another active connection ?!? PCU socket connected to external PCU Sending rts request: is_ptcch=%d arfcn=%d block=%d Sending data indication: sapi=%s arfcn=%d block=%d data=%s Updating SI%s to PCU: %s Revoking SI%s from PCU Failed to send SI%s to PCU: rc=%d OsmoPCU version %s connected SI%s is not available on PCU connection Unknown TXT_IND type %u received ActivateDeactivateReceived %d bytes on PCU Socket, but primitive hdr size is %zu, discarding Received %zu bytes on PCU Socket, but primitive %s size is %zu, discarding pcu_prim->u.data_reqReceived PCU Prim for non-existent BTS %u Data request received: sapi=%s arfcn=%d block=%d data=%s Rx malformed DATA.req for PCH pcu_agchReceived PCU data request with not existing TRX %d Received PCU data request with not existing TS %u %s: Received PCU DATA request for non-PDCH TS %s: Received PCU DATA request for inactive lchan Received PCU data request with unsupported sapi %d pcu_prim->u.pag_reqPaging request received: chan_needed=%d length=%d (dropping message because support for PCU_IF_MSG_PAG_REQ is not yet implemented) pcu_prim->u.act_req%s request received: TRX=%d TS=%d %s request, but lchan is not of type PDTCH (is %s) %s request, but lchan in dyn TS is not configured as PDCH in lower layers (is %s) pcu_prim->u.txt_indpcu_prim->u.containerReceived %zu bytes on PCU Socket, but primitive container size is %zu, discarding Received unknown PCU msg type %d Sending RACH indication: qta=%d, ra=%d, fn=%d Paging identity too large (%d) PCU socket not created, ignoring paging message Sending DATA.cnf: sapi=%s msg_id=%08x struct pcu_sock_statestate->srv_linkPCUIFCould not create %s unix socket: %s Started listening on PCU socket (PCU IF v%u): %s PCH_2AGCH_2PHYS INFO%s Sending PHYSICAL INFORMATION to MS. handover.c%s T3105 timeout (%d resends left) %s is in not active. It is in state %s. Ignoring %s NY1 reached, sending CONNection FAILure to BSC. %s RACH on dedicated channel received, but ra=0x%02x != expected ref=0x%02x. (This is no bug) %s handover RACH received on %s?! %s RACH on dedicated channel type %s received with TA=%u, ref=%u %s failed to modify channel after handover %s Starting T3105 with %u ms %s First valid frame detected BDFH468:456789:;Incorrect OM hdr length value %d %zu msg_utils.cFOM header insufficient space %zu %zu %s failed to decode AMR RTP (length %zu, %p) %s unsupported AMR FT 0x%02x %s Have to send %s frame on TCH but SID buffer is empty - sent nothing Ipa header insufficient space %d %zu Incorrect ipa header msg size %d %zu IPA length shorter than OSMO header Om header insufficient space %d %zu Incorrect om mdisc value %x Incorrect om placement value %x %x Incorrect om sequence value %d No ManId Length Indicator %zu Insufficient message space for this ManId Length %d %zu Manuf Label Unknown %s ramp_timer_cb(cur_pout=%d, tgt_pout=%d, ramp_att=%d, therm_att=%d, user_gain=%d) tx_power.c%s ramping TRX board output power to %d mdBm. %s bts_model notifies us of %d mdBm TRX output power. However, it should be %d mdBm! , bypass%s power_ramp_start(cur=%d, tgt=%d%s) %s Asked to ramp power up to %d mdBm, which exceeds P_max_out (%d) %s target_power (%d mdBm) is below or equal to 'power ramp max-initial' power (%d mdBm) yyy%s{%s}: Timer expired waiting for ramp down complete bts_shutdown_fsm.c%s{%s}: Timer expired waiting for TRX close %s{%s}: %s TRX closed, %u TRX remaining %s{%s}: %s Ramping down complete, %u TRX remaining %s{%s}: No TRX is operational, skipping power ramp down %s{%s}: Shutdown process completed successfully, exiting process osmo_fsm_register(&bts_shutdown_fsm) == 0%s{%s}: BTS is already being shutdown. %s{%s}: Shutting down BTS, exit %u, reason: %s fi=NULL%s{%s}: %s Received TRX close cb rc=%d BTS_SHUTDOWNBTS_SHUTDOWN_EV_STARTBTS_SHUTDOWN_EV_TRX_RAMP_COMPLBTS_SHUTDOWN_EV_TRX_CLOSEDWAIT_RAMP_DOWN_COMPLWAIT_TRX_CLOSEDEXIT++++++++++++++++++++!+++++++++++++++++(P@(P@l1sap_rtp_rx_cb(d\ Ȏ ؎ Ў  plx%s RTP clock out of sync with lower layer: %u vs %d (%u->%u) l1sap.c%s Ignoring an Access Burst on %s: BER10k(%u) > BER10k_MAX(%u) %s Ignoring an Access Burst on %s: ToA(%d) exceeds the allowed range (%d..%d) %s Ignoring an Access Burst on %s: link quality (%d) below the minimum (%d) %s radio link timeout counter S is already 0 %s decreasing radio link timeout counter S=%d -> %d %s radio link timeout counter S reached zero, dropping connection %s increasing radio link timeout counter S=%d -> %d rc >= 0GSMTAPMPH INFOTCHDATA%s %s %s meas ind, ta_offs_256bits=%d, ber10k=%d, inv_rssi=%u, C/I=%d cB %s %s Skipping RTP frame with lost payload %s assuming active lchan, but state is %s %s Rx PH-DATA.ind chan_nr=%s link_id=0x%02x len=%d %s No lchan for chan_nr=%s %s There can be no DATA.ind on PTCCH/U. This is probably a bug of the BTS model you're using, please fix! %s UL-SACCH repetition: inactive => active %s UL-SACCH repetition: active => inactive %s %s Lost SACCH block l1sap_prim%s No lchan for PH-RTS.ind (chan_nr=%s) %s %s Rx TCH-RTS.ind bits_per_20ms != 0%s %s Tx TCH.req %s %s DL TCH Tx queue underrun msgb_l2len(msg) == 240%s %s Invalid TCH mode in TCH-RTS.ind under CSD NT PH-RTS-IND%s BTS model is sending us PRIM_INFO_TIME for TRX %u, please fix it %s Rx MPH_INFO time ind %s Invalid condition detected: Frame difference is %u-%u=%u > 1! unknown MPH_INFO ind type %d %s get_lchan_by_chan_nr(chan_nr=%s) yields NULL for PRIM_INFO_ACTIVATE.conf %s activate confirm chan_nr=%s trx=%d %s deactivate confirm chan_nr=%s trx=%d unknown MPH_INFO cnf type %d %s Rx PH-RTS.ind chan_nr=%s link_id=0x%02xd %s RTS without msg to be reused. Please fix! %s %s no looped PDTCH message, sending empty %s %s looped PDTCH message of %u bytes %s %s Forward RLL RELease INDication to the BSC %s DL-SACCH repetition: inactive => active %s DL-SACCH repetition: active => inactive rep_sacchrep_facch_0rep_facch_1%s Tx PH-DATA.req chan_nr=%s link_id=0x%02x %s No lchan for TCH.ind (chan_nr=%s) %s %s Rx TCH.ind msg->len == GSM_HR_BYTES%s Rx PH-RA.ind %s Access Burst for continuous Timing Advance control (toa256=%d) %s Access Bursts on PDTCH/U are not (yet) supported %s Attempting to set invalid Timing Offset value %d (MS TO = %u)! %s RACH for packet access (toa=%d, ra=%d) %s RACH for RR access (toa=%d, ra=%d) unknown prim %d op %d%s Rx -> RTP: %s TX packet data %s is_ptcch=%d trx=%d ts=%d block_nr=%d, arfcn=%d, len=%d %s %s(): incoming RTP truncated: %u -> %u -shadow%s Trying to activate already active channel %s %s Activating channel %s bts%u-trx%u-ts%u-ss%u%s%s Trying to deactivate already deactivated channel %s %s Deactivating channel %s %s Deactivating SACCH on channel %s %s Modifying channel %s ActivatingDeactivating%s Channel %s is not an active ASCI type channel. %s %s uplink access detection on channel %s ȉԉ܉select_next_smscbcbch.c:327cbch.c:333cbch.c:335cbch.cCBCH-EXTENDEDCBCH-BASIC%s %s: No cur_msg; requesting NULL block %s %s: cur_msg has only %u blocks; requesting NULL block to_copy >= 0%s %s: deleting fully-transmitted message %p cbch.c:148%s %s: keeping fully-transmitted default message %p %s: Cannot process SMSCB of %u bytes (max %zu) struct smscb_msgRSL SMSCB COMMAND (chan=%s, type=%s, num_blocks=%u) RSL SMSCB COMMAND (chan=%s, type=%s): OVERFLOW cbch.c:223cbch.c:235cbch.c:242cbch.c:246%s: %s: Dequeued msg %s: %s: Using default msg %s: %s: No queued msg nor default NORMALSCHEDULEDEFAULTNULL &2    RaisingLoweringpower_control.c%s Rx UL Measurement Report: ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s Failed to calculate dBm for power ctl level %u on band %s %s Failed to retrieve power level for %d dBm on band %d %s Keeping MS power at control level %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s %s MS power control level %d (%d dBm) => %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s Rx DL Measurement Report: RXLEV-FULL(%02u), RXQUAL-FULL(%u), RXLEV-SUB(%02u), RXQUAL-SUB(%u), DTx is %s => using %s %s Keeping DL attenuation at %u dB: max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] %s %s DL attenuation %u dB => %u dB:max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] ȖhЖdؖDcsT Ve i,t4r@ď Pď \ď signal %u received BTS: SIGINT received -> shutdownSIGINTOsmoBTS contextsum-hc:d:Dc:sTVe:i:t:r:Some useful options: -h --help this text -d --debug MASK Enable debugging (e.g. -d DRSL:DOML:DLAPDM) -D --daemonize For the process into a background daemon -c --config-file Specify the filename of the config file -s --disable-color Don't use colors in stderr log output -T --timestamp Prefix every log line with a timestamp -V --version Print version information and exit -e --log-level Set a global log-level VTY reference generation: --vty-ref-mode MODE VTY reference generation mode (e.g. 'expert'). --vty-ref-xml Generate the VTY reference XML output and exit. Regression testing: --vty-test VTY test mode. Do not connect to BSC, do not exit.%s: Unknown VTY reference generation mode '%s' Generating the VTY reference in mode '%s' (%s) %s: error parsing cmdline options Command line argument '-r' is deprecated, use VTY cpu-sched node setting 'policy rr %d' instead. Command line argument '-i' is deprecated, use VTY parameter 'gsmtap-remote-host %s' instead. Command line argument '-t' is deprecated and does nothing, TRX number is calculated from the VTY automatically. ((*)) | / \ OsmoBTS --- VTY test mode: not connecting to BSC, not exiting --- Failed to create BTS Site Manager structure Failed to create BTS structure Setting SCHED_RR priority(%d) failed: %s unable to open bts Failed to parse the config file: '%s' You need to configure at least phy0 TRX %u has no associated PHY instance Command line argument '-i %s' overrides 'gsmtap-remote-host %s' from the config file main.c:356Setting up GSMTAP Um forwarding '%s'->'%s:%u' Failed during gsmtap_source_init2() Error initializing telnet PCU L1 socket failed Osmux setup failed osmo-btsunable to open PHY link(s) Error during daemonizehelpdebugdaemonizeconfig-filedisable-colortimestampversionlog-levelgsmtap-iptrx-numrealtimevty-ref-modevty-ref-xmlvty-testosmo-bts.cfg|lstruct phy_linkphy%u%s: PHY link state change %s -> %s phy_link.cstruct phy_instancepinst->trx == NULLpinst->trx->pinst == pinstphy_link.c:139phy_link.c:149phy%u.%u%s: This PHY instance is not associated with a TRX instance, check the configuration file! connectingT\dlxdtx_dl_amr_fsm.cUnexpected event %d Inexpected event %d DTX_DL_AMR_FSMVoiceONSETFACCHCompleteFIRST P1->P2InhibitSID-FIRSTSID-UPDATESID-FIRST (P1)SID-FIRST (P2)SID-FIRST (Inh, SPEECH)SID-FIRST (Inh, FACCH)SID-UPDATE (Inh, SPEECH)SID-UPDATE (Inh, FACCH)SID-UPDATE (NoInh)SID-FIRST (Inh, SPEECH, Rec)SID-FIRST (Inh, FACCH, Rec)SID-UPDATE (Inh, SPEECH, Rec)SID-UPDATE (Inh, FACCH, Rec)SID-UPDATE (AMR/HR)ONSET (SPEECH)ONSET (FACCH)ONSET (SPEECH, Rec)ONSET (FACCH, Rec)3H x f  f f(  f hH h hH h hH  h @hH hȼ hH  hȯ 0hH hȢ hHl                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                $$$$%%%%&&&&    """"    """"####$$$$%%%%&&&&####$$$$%%%%&&&&    !!!!""""    !!!!""""####$$$$%%%%&&&&####                                                               BCCH+CCCHBCCH+CCCH+SDCCH/4+SACCH/4BCCH+CCCH+SDCCH/4+SACCH/4+CBCHSDCCH/8+SACCH/8SDCCH/8+SACCH/8+CBCHTCH/F+SACCHTCH/H+SACCHlateearly%s Keeping current TA at %u: TOA was %d ta_control.c%s %s TA %u => %u: TOA was too %s (%d) nm_bts_sm_fsm.cosmo_fsm_register(&nm_bts_sm_fsm) == 0NM_BTS_SM_OPDISABLED_NOTINSTALLEDDISABLED_OFFLINEENABLEDnm_bts_fsm.cnm_bts_fsm.c:66osmo_fsm_register(&nm_bts_fsm) == 0NM_BTS_OPnm_bb_transc_fsm.c rsl phy opstart%s{%s}: Not connecting RSL in OML-DUMMY! %s{%s}: Error connecting IPA RSL: %d %s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s nm_bb_transc_fsm.c:63osmo_fsm_register(&nm_bb_transc_fsm) == 0NM_BBTRANSC_OPnm_channel_fsm.c%s{%s}: BSC trying to activate TS while still in avail=dependency. Allowing it to stay backward-compatible with older osmo-bts versions, but BSC is wrong. nm_channel_fsm.c:62osmo_fsm_register(&nm_chan_fsm) == 0NM_CHAN_OPDISABLED_DEPENDENCYnm_gprs_cell_fsm.cosmo_fsm_register(&nm_gprs_cell_fsm) == 0NM_GPRS_CELL_OPnm_gprs_nse_fsm.cosmo_fsm_register(&nm_gprs_nse_fsm) == 0NM_GPRS_NSE_OPnm_gprs_nsvc_fsm.cosmo_fsm_register(&nm_gprs_nsvc_fsm) == 0NM_GPRS_NSVC_OPnm_radio_carrier_fsm.c setattr%s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s%s nm_radio_carrier_fsm.c:52osmo_fsm_register(&nm_rcarrier_fsm) == 0NM_RCARRIER_OPstruct asci_notificationAdded ASCI Notification for group call reference %s notification.cDeleting ASCI Notification for group call reference %s notification.c:91Deleting all %u ASCI Notifications of BTS notification.c:109gcr_bvchd_bv= DRSLA-bis Radio Siganlling Link (RSL)DOMLA-bis Network Management / O&M (NM/OML)DRLLA-bis Radio Link Layer (RLL)DRRLayer3 Radio Resource (RR)DMEASRadio Measurement ProcessingDPAGPaging SubsystemDL1CLayer 1 Control (MPH)DL1PLayer 1 Primitives (PH)DDSPDSP Trace MessagesDPCUPCU interfaceDHOHandoverDTRXTRX interfaceDLOOPControl loopsDABISA-bis Intput SubsystemDRTPRealtime Transfer ProtocolDOSMUXOsmux (Osmocom RTP multiplexing)DASCIASCI (Advanced Speech Call Items: VGCS/VBS)(<LOML link was closed early within %llu seconds. If this situation persists, please check your BTS and BSC configuration files for errors. A common error is a mismatch between unit_id configuration parameters of BTS and BSC. abis.cevent == ABIS_LINK_EV_SIGN_LINK_DOWNE1L(%u) Signalling link down OML Signalling link up RSL Signalling link for TRX%d up TRX%d does not exist! Input Signal %s received for ts-%u-%u link_type=%s %s{%s}: List of BSCs to connect to is empty! priv->current_bsc%s{%s}: BTS is shutting down, delaying A-bis connection establishment to BSC %s{%s}: No BSC available, A-bis connection establishment failed A-bis connection establishment to BSC (%s) in progress... eth0ipaevent == ABIS_LINK_EV_VTY_RM_ADDRDrop Tx OML msg, OML link is down msg->trxCannot determine remote IP Addr: %s sin.sin_family == AF_INETNo BSC configured, cannot start BTS without knowing BSC OML IP abis_linkbts->abis_link_fistruct abis_link_fsm_privabis_link_fsm_privosmo_fsm_register(&abis_link_fsm) == 0WAIT_RECONNECTCONNECTINGCONNECTEDFAILEDSIGN_LINK_OML_UPSIGN_LINK_DOWNVTY_RM_ADDRIPA/ABIS/OSMOABIS_OSMO_PCU message too short abis_osmo.cRx BSC->BTS%d ABIS_OSMO_PCU msg type %u OSMO message unknown extension %u Releasing unused osmux handle for %s osmux.cosmux.c:155osmux.c:156Cannot find Osmux input handle %p osmux sendto(%s) failed: %s OSMUXcannot allocate message cannot receive message Cannot find lchan for %s CID=%d %s received RTP frame too short (len = %d) Osmux CID %u is back to the pool 127.0.0.1*Failed binding Osmux socket to %s:%u Osmux socket listening on %s:%u All Osmux circuits are in use! Allocating Osmux CID %u from pool lchan->abis_ip.osmux.useosmux.c:448lchan->abis_ip.connect_ip != 0lchan->abis_ip.connect_port != 0Using existing OSMUX handle for rem_addr=%s osmux.c:179Created new OSMUX handle for rem_addr=%s %s Cannot allocate input osmux handle %s Cannot open osmux circuit %u struct osmux_handle%s RTP->L1: Dropping unexpected AMR encoding (bw-efficient?) %s rtp_input_preen.ccsd_rlp.cdata_len == 120data_len == 290<<$$csd_v110.clchan->tch_mode < ARRAY_SIZE(csd_v110_lchan_desc)data_len == CSD_V110_NUM_BITS(desc)((((((()) ) $) 0) @) H)\)p))SW_ACTRX_SETATTRRX_OPSTARTOPSTART_ACKOPSTART_NACKSHUTDOWN_STARTSHUTDOWN_FINISHOML_UPRSL_UPRSL_DOWNPHYLINK_UPPHYLINK_DOWNDISABLEBBTRANSC_ENABLEDBBTRANSC_DISABLEDRCARRIER_ENABLEDRCARRIER_DISABLEDWrite Only attributeValue is out of rangeOK%uOOMset_therm_att(trx=%p, tpp=%p) max-ber10k-rachoml-alertthermal-attenuationGDrpnnoHooo phppprZ%3j# Wf ] ~+ ,4+ o. O `  hRhQoXPoo8M^ ]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]4t$tt$x<l\ȮD(dԭp @dDPḏ ,HԳ<(̲(qsrdtrdnTi hpli ,,lA@98@7doT738f335,3D2ft2t1f16h_6D6?\6&QM%N,NHNMHML0LK(<K8KLKJJJ 8JIII(4IHl*H`H|HG HG8GFPGF,*FHL;LE0 FlED0EDh(DdD\DDl/CBl/CxB8BlA` A@@@8@?8/?X?ph?>,$?>>=>@=``=<<;<0.10.,0l0p0/-/.$/p.).- .PhP(QDP)XPOPpPOxOpOO8OPONxNNN)QN,N'Q;x#$;P:L#:9 #9<9`98:880 887\+7+B,*C*X)D)'hD(%D$&5*54'4 4|&,4-X%-$-7#p--0"-%-PPQhQ8tQQ,dXQRlp|ydy >LwEyCCytAAzLGhy y D z T``ș<p,d @ ` |h D@К$d{ `,( tH044t| `4(8  X  |  L| `(0`Ht} `(  T@  P ~ `t#(#  T0"   t \ ` ~ `D(()$ T&$ %$$$H< `,(`-,* T+* X*))) `3(4P3(/.$4 .08@dlt$,@H`h ,4PX|D B4A@,d 4KD  KG?X> L>*xTx0w*xw(w)wxdwGCC: (GNU) 6.4.0AAaeabi7Cortex-A15 A   "*,D@q<d,|q$]~Ky<)z z@dP~$]~`@q|q../sysdeps/arm/start.S/usr/src/debug/glibc/2.25-r0/git/csuGNU AS 2.28.0 X%YJzLintGSN~[R../sysdeps/arm/crti.S/usr/src/debug/glibc/2.25-r0/git/csuGNU AS 2.28.0dyz../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/arm/bpabi.S/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/libgccGNU AS 2.28.0xzz../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/arm/lib1funcs.S/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/libgccGNU AS 2.28.0UP ( z@"int> JzL 7ExS 6 , C    h     $ ( , n0 t4 i,8  ,< @ \D jF zG H !P )SX q*S\ +S` ,Sd .3h /,l 1p z n 7n 7t b,=  6  ' ; <=tttt,   , y 66M,aaag "t $t #k 1, 6,H :,  .  , 0  ,  ,/ *>9 /&,;a 6G,  ;> c!\ (   $ M  (U  P !"G#O$%#& ' ()\* +,- . /] 0 12G3i 45X6789:; < = > ?@A B CxDExFG=H IVJKLMN OPQR+ST4U=VFWXYZ [\ ]N^X_-`6 a b cd e f$ghq %  H  @ -  >\> @U   zr     { P  ! E Gd P,7 Q, u R TR W, Y Ac&> M!s v> TK`@g \ I ^ - _rev `,  a! b bK { c n, > i T`lx*> l. 9 f  W !@    , ,  ,p ,p , , , , ,b , , , , , , ,O , ,` ,+ ,= , ,h ,O ,S , , , , , =     > 4  3  L0   > , uUX z,{>~E%  z  lowh h  s ll~    c     p  z@Rn d rpR!nn !dd !rr "d0s "d1s "n0s `"n1s "n2s "q0s "q1s @"bs "bms !ww #( $ 6s $ 6s $P 6s 5$K 6s k$ 6s $ 6s "__m6s #$ [s +$ [s >$P [s Q$K [s |$ [s $ [s "__m[s %$}$ `s $ `s 2$P `s K$K `s v$ `s $ `s "__m`s &@"m1s "m0s _#X:$ s $ s $P s $K s  $ s < $ s r "__ms &x$   b =%P~int<, \\b w % w w}S (Q *Q %,Q .Q 0 }1 m_~CP~}C% Cw- 8CwK V7w ~,siW, ~PvQwRx~}7[z../sysdeps/arm/crtn.S/usr/src/debug/glibc/2.25-r0/git/csuGNU AS 2.28.0%% $ > $ > &I4: ; I?U%%%% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8  : ; : ;I.?: ;'I@B: ;I : ;I!4: ;I"4: ;I# U$4: ;I% & U% $ > : ; I&I$ > I! I ' I 4: ; I?< ' .?: ; '@B.?: ; '@B: ; I4: ; I 4: ; IB1.?<n: ; U%U- ../sysdeps/armstart.S@q/1/11.11/22q.4/HB /usr/src/debug/glibc/2.25-r0/git/csuinit.ch, ../sysdeps/armcrti.S|q?/0////]0~h ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armbpabi.SyL/gl ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.Sz  .//vz ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc-native/usr/lib/arm-poky-linux-gnueabi/gcc/arm-poky-linux-gnueabi/6.4.0/include/usr/include/bits/usr/include../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../include/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/gcc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.hz0P. .v. .u.f0.0j0P-//-2 </fM-0mRNf/ J1-0,11+1d0<<K0,L. hK/-0/L0J0/2,-1G1<<O<<VfXmNfI/ ) /usr/src/debug/glibc/2.25-r0/git/csu/usr/src/debug/glibc/2.25-r0/recipe-sysroot-native/usr/lib/arm-poky-linux-gnueabi.gcc-cross-initial-arm/gcc/arm-poky-linux-gnueabi/6.4.0/includeelf-init.cstddef.hP~.n.n.Jn..1KgI/eL P, ../sysdeps/armcrtn.S]/~7 | y<TH | ,zD | 8Tz@D$  BBBBB | 4P~B rBBBBB ~long long intlong long unsigned int/usr/src/debug/glibc/2.25-r0/git/csuunsigned char/usr/src/debug/glibc/2.25-r0/git/csu/init.cGNU C11 6.4.0 -march=armv7ve -marm -mfpu=neon -mfloat-abi=hard -mcpu=cortex-a15 -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -ftls-model=initial-execshort unsigned int_IO_stdin_usedshort intsizetypearm710tarm_arch_iwmmxt_shortbufARM_EQ_IO_lock_tarm600program_invocation_short_namestderrarm2__udivmoddi4arm6arm_fp_modelARM_PCS_AAPCS_IWMMXToptoptarm9BASE_ARCH_0BASE_ARCH_2BASE_ARCH_3BASE_ARCH_4BASE_ARCH_5BASE_ARCH_6BASE_ARCH_7cortexa15cortexa7fa606te_IO_write_endhighvfp_reg_typefmp626getdate_errUSItype_flagsarm610arm10e_cur_columnarm9ecortexa72cortexa53arm_ccfsm_statearm1022efa626cortexm0plussmallmultiply__clz_tabARM_VCarm_arch_xscalearm7tdmiscortexm0plus_IO_buf_endARM_VSARM_GEarm_tune_strongarmarm7complex floatARM_GTarm620regscortexa5cortexa8cortexa9__timezoneBASE_ARCH_7EMhashval_tBASE_ARCH_6KZarm740tarm_arch_arm_hwdiv_posarm_fpu_descstdoutall_fpus_IO_save_endopterrfa626tearm7dmistrongarm110BASE_ARCH_3Mmpcorenovfparm9tdmiarm_cond_codeARM_PCS_AAPCS_IO_backup_baseARM_PCS_AAPCS_LOCALarm_fpu_feature_setcortexr4cortexr5cortexr7cortexr8arm_arch_iwmmxt2VFP_NONE_fileno__pad2arm1156t2fs_sys_nerrprefer_neon_for_64bitscortexr4fsize_t_vtable_offset_markerscortexa12unspecv_stringscortexa15cortexa17_IO_read_basearm_arch3marm940tstdinarm920BASE_ARCH_4T_nextarm_regs_in_sequencereturn_used_this_functionBASE_ARCH_5TE_IO_markerarm1176jzfs_chainarm_lang_output_object_attributes_hookarm720tBASE_ARCH_5Earm7500fe_IO_2_1_stderr_processor_typearm_pcs_modearm_arch4tstrongarm1100arm700arm_tune_wbufhtab_hash_IO_read_ptrGNU C11 6.4.0 -march=armv7ve -marm -mfpu=neon -mfloat-abi=hard -mcpu=cortex-a15 -mtls-dialect=gnu -g -g -g -O2 -O2 -O2 -feliminate-unused-debug-types -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hiddenarm_arch_namecortexa32cortexa35arm_arch_notmarm_arch5eARM_LEBASE_ARCH_6JBASE_ARCH_6KBASE_ARCH_6MARM_LSARM_LT_IO_write_basestrongarm1110BASE_ARCH_6Zarm926ejsarm710_IO_2_1_stdin_arm_fpu_attr_IO_2_1_stdout__IO_save_basehtab_hash_pointerBASE_ARCH_5T__q0__q1arm7500arm968esBASE_ARCH_7AARM_FP_MODEL_UNKNOWNARM_MIarm_arch6karm_arch6mBASE_ARCH_7Rarm10tdmiarm920tarm720arm1136jshtab_eq__pad1arm946es__pad3__pad4__pad5__r0__r1ARM_PCS_AAPCS_VFParm_arch_no_volatile_cecortexa57BASE_ARCH_8Aarm700iARM_NEarm60featuresoptindARM_HIprogram_invocation_nameoptargARM_NVarm_arch4cortexm0smallmultiplyarm_arch6arm_arch7arm_arch8long doublecortexa57cortexa53/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/libgccarm_tune_xscalearm_arch5DWstructcortexa17cortexa7arm7di__quad_tmaking_const_tablethumb_call_via_labelarm1156t2s_IO_read_end__d0__d1ARM_PCS_APCSARM_PCS_ATPCScomplex doublearm922tarm_cc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/libgcc2.cunspec_stringsmpcorebase_architecturearm_arch_crc__t0arm1176jzsarm_current_ccfa526cortexa72__environarm966es_IO_FILE_plus__popcount_tabARM_PLDWunionmarvell_pj4BASE_ARCH_6T2BASE_ARCH_5TEJarm_tune_cortex_a9ARM_ALBASE_ARCH_7Marm_target_labelarm_target_insnarm250_lockxgene1pool_vector_labelarm1026ejs_old_offset_IO_FILEarm1136jfs_dont_use_rtx_here_arm70exynosm1UQItypeVFP_REG_D16arm_tunearm_cpp_interworkarm7d__tzname_sbufcortexm1smallmultiplyarm_arch_thumb_hwdiv_IO_write_ptrARM_FP_MODEL_VFPhtab_eq_pointerarm7marm_pic_registerfa726teARM_CCarm_ld_schedarm810ARM_CSVFP_REG_SINGLEarm7dm__off_tgenericv7aarm_base_arch_sys_errlistarm_arch7emarm7100arm_pcs_defaultVFP_REG_D32ARM_PCS_UNKNOWNep9312arm3arm_arch_thumb2cortexm0cortexm1arm8cortexm3cortexm4arm7tdmicortexm7UDItype_flags2arm_none__daylightarm1020earm710cqdf24xx_unused2_IO_buf_basearm_arch8_1arm1020t__off64_t__init_array_startenvp/usr/src/debug/glibc/2.25-r0/git/csu/elf-init.c__libc_csu_fini__fini_array_endsize__preinit_array_start__fini_array_startargcGNU C11 6.4.0 -march=armv7ve -marm -mfpu=neon -mfloat-abi=hard -mcpu=cortex-a15 -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -fPIC -ftls-model=initial-exec__libc_csu_initargv__preinit_array_end__init_array_endPQ%PQ % |PQ|H%HxPQx%PQ4%4<PQ<@%lRSl%RS % 8RS8H%HRS%RS% RS 4%4@RS HRHUR 8R@HXHTRTU R 4X4@R `SS SHdS(S4@S TPT\\P \P\,R,HQHxPt\\P\  \ 4R4<P<@\TQThWQ LQL\8\HQ$RQR Q  W 4\4@Q@`[`dqu%lTP0HPP 1 4P4@000H01  04@00HU 4U8V$ TXV4TXXX\Qu u dxTxtTTPpP\hwxpSRrx\|u"\lRQQWXSsSTtTtwRrwQqu"QPu@%u 4Y4TyXYh|P|pP$rw,lQ`lqwt|\||u"\(hPpXZWHZ 0W04SVHY 0V04Y\HW 4W\Zs  (s \pYpyYPpP\`{w`d qu%whVvw\|s",\ 4\dQZHVW 4VW/P/lVlP/Q/W/R/pXpR8<u2&<U8D0DPTP\t\dT|qq]]~~T,H 4DHLX\lpx]]~~Tp.8MXPhQ hR ] ] Hn ~~$*,*+ 4+ 8+ <+ ^ ` e P  !"#p;@q $*pq 3~e >;|q |q q ;] ;~;] ;~; | p ;Hn #Hn$ :d  ; T ;X  ; Qc(tDX;r u ;u ;ln ~~0Ђ Ђ ;> @8 Al tA C C 8E @LGL ;pn QpnH + LvgLv,y dy `lw;0 0 4 H, t,  (, ;  ;  R  ;n nnH + { { Ht;|  |     ,   ;X D  ;    R8  4 ;o oH + <| t| H; $ |  ;0 d ; X RH 8 ;l `h ;Ho HoH + | | H@,;    =  ;  L ; ` < ;| p R  z|  ;o oH + <} t} `\;\  \  `  t  = ,  , ; H ! ;(! `0"D d" ;t" t#x R# ;o oH + }  ~ `h;$ $ $ $ =$, $, (% ;%H % ;% `&H 4' ;D' D( R) ; p - pH $+ l~ B~ `Y;) ) ) ) =*, ,*, ;X*H * ;* `+H + ;+ l,x R`- ;hp hpH (+  < `; .  . . ;(/( X/ ;/ P3X 3| $4h R4 4 ;4 ;p pH ,+   HX;L> L>  (X> Dh>( S? g@ t4A B 4E, `Fx G\ 4K K P ;p pH 4x \   e =e (:e (e (2f (MDf (blf (tf (f (f ( g (4g ('\g (g (g (g ("g (5$h (OLh (fth (yh (Ԩ;" " # ;# % ;& , ;, / / ;/ ; ;; p;< з;l= l=h = @ A LB E "H H ;H 6 B̸Rܸ`;K iK PL vM| S ;S S ;S XW ;`W W ;X Z ;Z 4[ ;D[ P[ ;`[ _ ;_ d` ;t` c ;c ؂ .U؂ ܂ ,I,;e  ̕;g g hp h ;h h ;i j ;8j   x;dn dn + ln  np n 2oX Fo Vq er wr s dt h h h 4;u u 8t YD m H ;\  x4 4 4 4 H` L 4 $(4 9\h X4 n4 ,4 `4 4 4 4 0 0 `  % 8 <0" L"h W #, lL#, x#( # A`$ X%| % |&< 8'` ) )\ ,*@ l*@ * 1\+H =, I- f. . 8/4 l/ D0@ 0@ 08 1 20 N 4 +5 38 69 K: dp;@ ~p;@ p;@ p;@ ;x (< @= @> .D?l K? X@x oAx |A BP CL DL hD D  E  -F|S   h_H b ;b + bP & f 9 f D 8f M 8h, Z do c PpT t pT p  p XPi  i ( i ( i ( j (!Hj ($!pj (1!j (=!j (L!j (c!k (u!8k (!`k T!k (!k (!l (!,l (!Tl (!|l ("l ("l (:"l (R"m (k"Dm ("lm ("m ("m ("m (" n (#4n ("#\n (@#n (\#n (#n (#n (#$o (#Lo ($to (&$o (@$o (Z$o (s$p ($

1 \ ]1 n1 1;i 1;k 1k\ 1;m Pl1;r 1''1((1;w 2w 2(w +20w4 <2dwH S2wT g2xT {2Tx4 2xH 2x  2 2 24   )2;y  2< ;z 2;z ,*d 2;P~ ~ ;~ T,*3,*8+ 38+ "3` 834+ I3+ \3^ ;] ] ;] e338Pe 34t$ 3 33!d 3pD 3aD4Lw 448J4l444h$ 40 4`44<+ 55;5O5p5$ 5h $5T 55 55D 5 86 #6r< 76Z66606P6X 6i 6# 7/7H J7m7~77777\$ 7 8 8~ )8 68` D8" V8Xt j8( s8M, 8T 8L 8| 8<3 89 9ܲ &9P 69,7$ I9l9~9|  99 > )>;   G>l  Z>Pt r>d  >< >>> >?X ?(?Dx C?U?`t8 g?? ?J  ????@@>$ #8~,@ P 8@ S@q@L @@`Wp @@<| 8@z A A@AZArAA A\3 AAP, A Be BT5 6B\; \B|@ qB<= BBB: Bh B C6CUC$< vCC0hCCJ CCdy D#Dz" 1DCD`DqDd zD̈  Dli 8DDDDEDh EXm` 3EUE|Eu  EE EEF#F@ >FP PF-h iF{Fhv  FFFG((G =GgG @ {GhGX G= hG G  GL G&HD 8HOH؁dHP (xHHHdp H  Hh Hpl HI2I7\ JI^, \I@` gIIIII0p IIi Ju JH 9JQJ4  jJpL {JT JJ4 JJJh8` JxD Kz@ KTy 1KMK,4 lKM KNx KTd$ K|= HK= KL!LL 1L HLl~ 8XL  tL Li TL Ly L$, LL M\ M$MlS 5MQMl eM(  yMMMMM~M_XN N7N|4 RN( gNzN Nx N4 N7T N`X NNFy O/O$ d PPPh PL Q$QFQHh WQPP kQ`xQ47p Qxd Q QQr4 R(  RL R%R< 6RTRx cR#h qRR@8 RRpx RRS1SCSE ;VS fSSSSS 8S x (TT T  /T<} 8;Tn LTz" ZTq oT,m ~TT(Td TTX TT U5U EUl  VUy 8eUh yUU(HUMX U UUV VP7@ -VOV`zeVV} 8V$x VV Vhh W'WQW` aW* mW\F WWWLn WWj 8@ X.XXXsXK?NL XXdP XeH X XtH YH Y ,Ydt AY WYT sYY( Y"@ Y8x Yx Y  YԖ  Y< Z &Z7ZaZL mZZ ZZZ Z[L 1[D H[\[z[D [[ [[0, [4 \+\`^t :\ Y\t\\tP \;X \e \]8 ]']< 9]L H]b]D s]]]  ]]^ 6^V^H e^p9, w^0 ^( ^P~ ^!0 ^P ^0 f^|4 ^^  _+_<_P N_<  ^_  w_4 _ __h _0 _`0 `\ #`9``yd O` ^`p` ` ``LP `` `8 ` a8Mp $a  EaZah naaa,y 8aP ay aam b#b8 ?b Vbkb |b` bb(t bbo ccpt /c] Cc?Kcicc ucc  c0 c cH( ccd.d@dRdphcd@yd`H ddX dD4 dp d ee< +ex Ae`eee e< ee:ef\ fi@ -fBfgf_ yf| fL f ffffD fLt gP 4gh$ Igrg@ gJ ggH gD g@ gi g!hH 5hn ^0 Ehi Thuhd98 htv  hhhЄP  h  h| 8iH i0i L HiXR4 Riu ki }i:iii` ii؆` j.jp Gjajj0 jjjj8 jk.kd BkP, Rkzkkh kk  k k kl  2lh Glclh slTQ PllllL m!mT 2mRm  bm|mmmm mQ Hn  ,nQnfnnP nn nQ (nooDp *oT @o:P ^oqoop  o`k o( oc oR p!p8 :pZpp  p   pS p) pPpHpx q %q5qRqtqXuD qqO qP8 qx D30 q r4  r 6rNr gryrrtX rrrrst@ &s 9scs` ts` s4 ss$  sttp -tCtX [tl4 mt tP t tX tP8 t< tm t\y uԏ\ u #u0u$+ 9u4 Pupfup ruuuu uS v;v\v{vP vvv(v[ pvw0@ *L +wPwuw<>  wT} wD w,  w ww  xh !x:xSxd cxp xx@ xxxTD x xxly y` y2yEyVy@  myX yy8 yphyL yP9 yzzGz`zl4 qzzzD zm zz{ h {L ){[{k p{{( { {{{ {` { ||H *|>|, Q|# a|[ ~d( |#` |l ||  |; || }1} U}u} }}}h }| }~$~;~\ K~c~, {~~~~L`8~`t /e Je{p/ (< ( 0 :b (Rln yP O Y] ۀ \ ,:h