ELF(i44 ('&p   444  TTT$VdhhhhhDDQtdRtd44/lib/ld-linux.so.3GNUGNU3\ҬVSx@ A)!U FPA Pl@ "2+o AAE Xd2 "^ `F" T M*Ra<BCTKT #d X)@;8 CB ]Ab('#V  .! dDŠ#$@@(h9@*)S(F aNP+ y B !"#$&)*+,-./123456789:;=>?@ABCDEGIJKLMNOPQRSTUVWXYZ\]^_`acdfgijklmnpqrtwyz{|}     !"#$%')*,-./0123456789:;<>?@BCDEFGIJLNOQRTUVWXYZ]^_`acdefghijkmnoqrstuwxM|Ml/[703Vs|;Xy? ΥfYE̅.TI?~|7 דLc\nhg$aJ;P7TW@mthlId e L{d.06,ĖìÎ3,>iJ&UHLe?<| ͈Eޤ{W6{FQkK3uicK.7[;'q/ C6vכ|vɑF3,%u OjhXeoMWP9ځz -W{?x|3qJEK=&.Vo|1GB`,/Қ糭6I<9 )+F7AM|} BMjm(9:HGkCffc]1 ^#BwT<㸏hq>Ɗ۲di5|$}MWS@oϱBGXϒc9vĥDnV p^-HW).Kë(cS.\ <)1 DI#%2m Uq5m*X.Lu'&zCv>&'oKR}3Ϥ+lqc{{kƛK_%0 +l{ pcYcKqwaٯ!T[#%5bQ멦'dߍ~o׹}oLjL܇Gq}ZCV (k?s,T mޓqX gUMv=rs_gI4AkyM%bģd/]nX%k߾YhqXCj*+Y fɔQ;r͟i.#BNmtֽ T3u\4V8OA䐉6ܑ]iO'鷺$v&$v炉! )ww% \kPqmY{9DYK}&27eS.{{%NWSVyܾ]#+` R ; R  f R) R`! / PThf L 2lp _t >h  7 " >XX!  gA  -! (DwiB`Eoz_   \  ? ) YI  `?Y  f] \YI,! O{v< x! /  <|HTP1p! or}  /p 8h! OW JGt PX ]/ d! & z: u]X Q E$! JX7  $,,! D] \RHI/ _;9 5 n 2 ,Qw^k:3 aVM  &Y%Cpe%w< h  P  ?"c~'  j A |=~& ^* n,!  = /  t); |fNH  .pk (( (o DL R0! (lf([/Alibosmoctrl.so.0_ITM_deregisterTMCloneTableinstall_node__gmon_start__vty_out_Jv_RegisterClasses_ITM_registerTMCloneTablectrl_interface_setupctrl_parse_get_numctrl_cmd_def_makectrl_cmd_installctrl_vty_initctrl_cmd_def_sendctrl_cmd_def_is_zombielibosmoabis.so.15osmo_stream_srv_create2osmo_stream_srv_link_destroyosmo_stream_srv_set_read_cbosmo_stream_srv_link_openosmo_stream_srv_get_dataosmo_stream_srv_link_set_datavty_out_rate_ctr_grouposmo_stream_srv_link_set_addrosmo_stream_srv_link_set_nameosmo_stream_srv_link_set_accept_cbosmo_stream_srv_sendosmo_stream_srv_link_createosmo_stream_srv_link_get_dataosmo_stream_srv_destroyosmo_stream_srv_set_closed_cbe1inp_ipa_bts_rsl_close_ne1inp_line_bind_opse1inp_line_updatee1inp_signal_nameslibosmo_abis_inite1inp_line_createe1inp_signtype_namee1inp_ts_config_signe1inp_sign_link_destroye1inp_ipa_bts_rsl_connect_ne1inp_line_find_finiabis_sendmsge1inp_vty_inite1inp_sign_link_createlibosmotrau.so.11osmo_fr_check_sidosmo_hr_check_sidosmo_efr_check_sidosmo_hr_sid_resetosmo_fr_sid_classifyosmo_efr_sid_classifyosmo_rtp_socket_createosmo_csd_ra2_16k_packosmo_csd144_to_atrau_bitsosmo_rtp_send_frame_extosmo_rtp_socket_set_ptosmo_rtp_skipped_frameosmo_rtp_socket_statsosmo_csd_ra2_16k_unpackosmo_rtp_socket_pollosmo_rtp_socket_set_dscposmo_rtp_socket_freeosmo_csd_ra2_8k_packosmo_rtp_socket_set_priorityosmo_rtp_socket_log_statsosmo_rtp_socket_set_paramosmo_csd144_from_atrau_bitsosmo_rtp_socket_bindosmo_rtp_initosmo_rtp_socket_connectosmo_csd_ra2_8k_unpackosmo_rtp_set_source_descosmo_rtp_get_bound_ip_portlibosmocodec.so.4osmo_amr_type_namesosmo_fr_sid_resetosmo_ecu_destroyosmo_amr_rtp_decosmo_ecu_initosmo_ecu_frame_outosmo_hr_sid_classifyosmo_ecu_is_dtx_pauseosmo_ecu_frame_inosmo_efr_sid_resetlibortp.so.10libpthread.so.0recvfromraisesendto__errno_locationlibrt.so.1clock_gettimelibosmonetif.so.11osmux_xfrm_input_deliverosmux_xfrm_output_allocosmo_rtp_buildosmux_xfrm_input_set_batch_factorosmux_xfrm_input_open_circuitosmux_xfrm_output_set_rtp_msgb_alloc_cbosmux_xfrm_output_set_rtp_ssrcosmux_xfrm_input_set_nameosmo_rtp_handle_createosmux_xfrm_output_set_rtp_pl_typeosmo_stream_srv_link_set_typeosmux_xfrm_output_set_tx_cbosmux_xfrm_input_set_deliver_cbosmo_stream_srv_link_set_msgb_alloc_infoosmo_rtp_handle_freeosmo_stream_srv_link_set_domainosmux_xfrm_input_close_circuitosmux_xfrm_input_set_batch_sizeosmux_xfrm_inputosmux_xfrm_input_get_deliver_cb_dataosmo_stream_srv_link_set_tx_queue_max_lengthosmux_xfrm_output_schedosmux_xfrm_output_pullosmux_xfrm_input_allocosmux_xfrm_input_set_initial_seqnumlibosmogsm.so.20abis_mm_event_cause_namesdbm2rxlevosmo_csd_12k_6k_encode_framelapdm_phsap_dequeue_prim_fnlapdm_t200_fnosmo_tlvp_mergeabis_nm_pchan4chcombabis_nm_att_namestlv_def_patchgsm0858_rsl_ul_meas_encrsl_chan_nr_strabis_nm_att_tlvdefosmo_csd_12k_6k_decode_framegsm48_chan_mode_namesrsl_att_tlvdefabis_nm_nack_cause_nameabis_nm_ipa_magicgsm48_number_of_paging_subchannelstlv_parsersl_ipac_eie_tlvdefrsl_err_nameosmo_rlp_decodegsm_band_parselapdm_phsap_uplapdm_channel_exitlapdm_channel_set_flagsrxlev2dbmabis_nm_dump_fohosmo_gsm48_rest_octets_si3_encodeosmo_gsm48_rest_octets_si3_decodeosmo_gsm48_rest_octets_si4_encodelapdm_channel_set_t200_fnlapdm_channel_init3osmo_tlvp_copyms_pwr_dbmosmo_gsm48_rest_octets_si4_decodeosmo_bts_features_descsosmo_gsm48_si1ro_nch_pos_decodeabis_nm_put_sw_filems_pwr_ctl_lvlgsm48_rr_msg_namersl_rll_push_l3lapdm_rslms_recvmsgabis_nm_osmo_att_tlvdefabis_nm_adm_state_namesrsl_or_ipac_msg_nameabis_nm_opstate_nameabis_nm_avail_namegsm0502_calc_paging_groupgsm_fn2gsmtimegsm_gsmtime2fnrsl_msg_nameabis_nm_fail_evt_vrepgsm_band_nameabis_nm_obj_class_namesabis_nm_att_tlvdef_ipagsm_chan_t_namesrsl_act_type_namesipa_prepend_header_extabis_nm_osmo_magicgsm0808_chosen_enc_alg_namestlv_parse2lapdm_channel_set_l1lapdm_channel_set_l3gsm_fn_as_gsmtime_strosmo_dump_gsmtimeosmo_csd_3k6_encode_framersl_rll_simplegsm_arfcn2band_rcosmo_plmn_from_bcdabis_nm_chcomb4pchangsm0502_fn2ccch_blockosmo_sitype_strsrsl_ipac_msg_nameabis_nm_msgtype_namesosmo_csd_3k6_decode_frameosmo_rsl2sitypelibosmoisdn.so.0osmo_v110_decode_frameosmo_v110_encode_framelibosmovty.so.13osmo_tdef_vty_groups_initcfg_no_description_cmdvty_cmd_string_from_valstrosmo_tdef_vty_groups_writevty_ref_gen_mode_namesvty_ref_gen_mode_desclogging_vty_add_deprecated_subsysosmo_talloc_vty_add_cmdsprint_versionvty_read_config_fileosmo_cpu_sched_vty_initinstall_element_veinstall_elementosmo_stats_vty_add_cmdslogging_vty_add_cmdscfg_description_cmdosmo_fsm_vty_add_cmdsosmo_log_vty2tgttelnet_init_defaultvty_dump_xml_ref_modelibosmocore.so.22osmo_tdefs_resetlog_parse_category_maskmsgb_alloclogp_stubosmo_get_macaddrrate_ctr_initget_value_stringosmo_init_ignore_signalsosmo_stats_initgsmtap_source_add_sinkbitvec_set_bit_pososmo_fsm_registerlog_get_filter_dataosmo_wqueue_initosmo_wqueue_enqueueosmo_log_infoosmo_ubit2pbit_extosmo_crc8gen_compute_bitslog_set_log_levelmsgb_dequeueosmo_timer_pendingmsgb_hexdumposmo_fsm_state_nameosmo_sockaddr_str_from_in_addrlog_reset_contextgsmtap_source_init2bitvec_get_uint_osmo_fsm_inst_dispatchosmo_timer_setuplogp2bitvec_set_bytesosmo_fd_closerate_ctr_addosmo_init_logging2_osmo_tdef_fsm_inst_state_chgosmo_vlogpmsgb_lengthosmo_pbit2ubitmsgb_datagsmtap_send_exrate_ctr_group_alloclog_set_contextosmo_hexdump_nospcosmo_sockaddr_str_from_sockaddrget_string_valueosmo_timer_scheduleosmo_hexdumposmo_panicbitvec_set_uintmsgb_freeosmo_sockaddr_to_strget_value_string_or_nullbitvec_set_bitosmo_tdef_getosmo_fd_unregistermsgb_talloc_ctx_initbitvec_allocosmo_sockaddr_cmposmo_isqrt32osmo_stderr_targetosmo_fsm_inst_namemsgb_copyosmo_fd_setuposmo_fsm_inst_update_id_flog_set_use_colorbitvec_get_bit_pososmo_daemonizeosmo_str_tolowerlog_check_level_osmo_fsm_inst_state_chgosmo_fd_update_whenosmo_strlcpymsgb_enqueueosmo_timer_delosmo_sock_init2_ofdosmo_sockaddr_to_str_bufbitvec_freeosmo_fd_registerosmo_signal_register_handlerbitvec_unpackrate_ctr_group_resetosmo_select_mainosmo_signal_dispatchosmo_fsm_inst_freelog_set_print_timestamposmo_signal_unregister_handlerosmo_fsm_inst_alloclog_get_filterlog_set_filter_datalog_set_filtergsmtap_sendrate_ctr_group_get_ctrlog_get_contextlibdl.so.2libtalloc.so.2_talloc_memdup_talloc_set_destructortalloc_pooltalloc_strdup_talloc_zerotalloc_named_const_talloc_freetalloc_asprintftalloc_set_name_consttalloc_report_fulltalloc_enable_null_trackinglibsctp.so.1libc.so.6fflush_IO_putcfopenstrncmpoptindperrorinet_ntoasignalputsabortgetpidinet_pton__assert_failstrtolstrlenmemsetwritevfseekmemcmpgetnameinfostdout__isoc99_fscanfstrnlenmemcpyfclosestrtoulmallocsched_setschedulergetpeernameoptargstderrreadvgetopt_longfwritefreadfprintfgetsockname__xpg_strerror_r__xstatmemmoveopterrstrcmpstrerror__libc_start_mainrandomsnprintf_edata__bss_start__bss_start____bss_end____end___end/usr/local/jenkins-build/inst-osmo-bts-sysmo/libLIBOSMOISDN_1.0TALLOC_2.0.2GLIBC_2.4LIBOSMOCTRL_1.0LIBOSMOCORE_1.0GLIBC_2.7LIBOSMOGSM_1.0              q 7R " Gj ii T @q:^ q#n3 ii T00ii ~ii Tt  D <<w\\p$|Wb\Pt>tSTST30! jX! ,`!  d! h! p! x! {! ! 7 " ]    E _$ C( s, U0 4 58 < a@ D BH kL P T !X #\ r` ld h 'l gp t ,x e| I  R      R  J ]   n       D Q    *  "  Q   @ O u    a : }   $ ( , 0 4 8  < )@ nD bH 8L  P <T  X \ ` Td |h l p Zt x | .    o m 6 [ &  Y    F  z  G X  1   r   q  p  . 4 h   B      P  $ ( t, 0 ?4 8 !< @  D H L xP -T 'X \ F` _d h 8l  p t ox | *   x   > : `  K G   + $ 2   A  ^  M 0   w  f K  h     $ 5   /  H$ N( , j0 (4 8 A< @ VD %H L ^P T X \ &` d h gl p Ut x Z|  -  N H d =   \ Y k  # X   )    6  L  9 = O t  L i  v % c      ; W  M$ ( 0,  0 4 8 < @ D H L +P T ?X \ ` d ;h l 9p t x i| V E  < y d   c    `        u I e  3 ( y  f / \ @ 2     J v 4 q C  $ [( l, 0 D4 8 m< @ @--@Əzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌƏzʌxƏzʌpƏzʌhƏzʌ`ƏzʌXƏzʌPƏzʌHƏzʌ@Əzʌ8Əzʌ0Əzʌ(Əzʌ ƏzʌƏzʌƏzʌƏzʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌxƏyʌpƏyʌhƏyʌ`ƏyʌXƏyʌPƏyʌHƏyʌ@Əyʌ8Əyʌ0Əyʌ(Əyʌ ƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌxƏyʌpƏyʌhƏyʌ`ƏyʌXƏyʌPƏyʌHƏyʌ@Əyʌ8Əyʌ0Əyʌ(Əyʌ ƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌƏyʌ@-G0 g#06^@-P0  Y  <6@-P0  K \l6@-P0  = ت6@-PQ?  / (6@-PO?  ! D6@-P0  Pd6@-P0 L 6@-P0  6@-PG?  | @Į6@-wP0 L -6  --- 0T g0 0 R/D00CS/0S///! ,! $$AA/0S//,! ,! @-@0S00! (0S0S @-3/@8@- ZdMh1` @ <'nPpP7  f b ^ Z V R N J F B > :: 0:&.dЍ`0 R P @00pC04 0C `!  :  !//C-p0 @Q@` `3 00,M 0`  "0 R KP p! A `0L  ,ЍC-@@0k! `!  $!O-@Mxxxp` PP 0  `p MP wP400@Ѝd !. !/0X0/U!0Soooooooooooooooooooooooo/// 0@-PMU@ PЍ0 L0@ 0@04 W00 `! |44@-0@-PM0@S x R PЍ0@ 0 00 00%0 0 `! 44G-`MD#0pP&X<@p@ds0SR hPz831S,#0!80 0 b04ZE QPU21S"80!00 P R8 :P0 Ÿ@ @ ,@(ЍT2TXP"00<"0$r 2 Mh 1C1X18S!0 0!0pEl100T!zwPU1 P 0$!0 0!0dЍPU P  0 0 0Il p0PP T0,4`! )`('&\t44l54(4 '055$5@5`5p@-8PMU@0 PU wP 00 0[0  `V aPo0h `0[X0L D0^00$ 00P^0`! '54(5p@-PMU8 U U U; AQrvLwwvvvwdvdvvvwvvwwww(v PU`3`#``\c 4 !b `B V&V@@UKЍp PP -B 2"7oEQ^wdvxwLxLxLxwwU 2@T^ P t2@(l2@@"eEQ,wxxwxxxwwЍp1`V@ P 10P@1 -B  -B  @  @ 1@T) P p1@(@d1D1@T" P <1@(@01P1 qP0 iP0 aP0 Y0 R RP 0  D04 p0 00`L0L{456ON6`! h66P68660C- MRP, A`0SP P pp!00!V> W14 0 h1h1\ 0 L1#0A`0S0 P@V, @T1 P ; 0 0 0o.#Ѝ萐p$0 Vtp|Lh <0 808 ,p`! 6(%64rs7f,7P~O-@PMh :1Sw  lpP02U`5V| PH40r0S6䱟`#LsP@M@ T U P@P P0M 0@Q Tsko VO V< PP$400S Ѝ r 00P0 0  0 0 00 pLp \0\@K$f 0A}`! p(%7 4<7`*6p7`7h70@-L@ MPT <40 $\0 Ѝ04HI- M00 V Ѝ- M00 N Ѝ-tMNP 80#< AQڶ3 0< 3ЍD0CD BY77O-pPDM001 :1S2 P`lU  [<0, 0C,0 @/0@S0  (0$ QQQPU PP00I 80 04, RZ @0 \( 0 0$ S i <  B\7[  GPP $7@T 9P$BP  0DЍ0 s#! $;Pb 40, I&Q Q !0 0 R84 ( 0QQQ \E Q  @Q0  Q0 PP08040r P0 @P Q 8 Q h\0040b;40S:84Sş< , I,0 84F 084@$r$0 `@\$00$u? 5a$,0P $0:<04400,0QP\ $ P :4$ R d$. Q <  BR$0$0#$0 `(e(0 0 3#$0 ` h3u`0804 0$0 `0,0(;( ,0 0 3k4 R> RJ 4 B,0$0Q 4 <  B]00 ,0R   R   R     ( 40<0  8 d840 084 4 0! 084q!10!!! I"!800 4 084^84Z81PU! P $0 `PpP800P@c?  Cx0 L$0 `pS00 p@ 0ctX0 R P x00Pp04  T0TON`! L8t94<7`*6`7h7\98 9X89$8WO-@|M0P0CpSA,PL`,[ EPOu0  00 0  0 S  S  000 P @T Ps jh@|Ѝ$0S T`R: !: 0 `  ! $P 0S #+R @ 0C0,0, <0#Ġ 0 P B@|Ѝ$0Ss T`P0 0(!P0V, L@6 0`@LP T0L"@$0SU  TpR8!8  ;`V P00CS`VC P LL(0  0<(<8#p$0S# T`R7 !7 0` ! $3pP07`V fP_@L0' `t l7 0`p\7<' 0 P0 ^ АX L@p6ZX -P  0 C G 0C0( $; 0p# "$p131"#80< $ AQr30%3<=K  <(0`   %0D0%5y:3+S@0, 0<0#@0 < 0    854#L`  5 !밌JH#00L00 0000)8C8<0/0P 00 C SR@0S 0 !<A SC10Qßt+\0@,<,@@ P@P03L\`岖ᴆ6$TX @C 00 H3L@5 p8 00p $3${(}S0  %0CĠAR#?A1c ! 0 0L @x$%0< @0hŸ< 00  L2" #0@0a J101! ~ @,L Dd.0$<0%(@ @0D 0<0 0 1s  0`e 0 0| 03~X 0HuD0CD L x2p/`! 3 / :4`796%9@F A:@X4gfff,:9;97(;@-@M|P 80#<\ AQ ڶ3z.z> 0< 3ЍD0CD B P;7O-P,M0 4  S  S S p5 RK (P@w,Ѝ r@P :!$0R] 0 04l@#1 10H #1RR0010 000 00 00[`\ %pPa 0 S   <@PC0 R&   屐 PrP' 0P 0a $0 !R0#^ %Q (!Z*j         "pPpP @fPU :!R 0AS6D"0  0"2E 0@S:=l`0S@,0S1@10S9 S[ @T< 2@$1 Rm CP !0 0!1@0! : L' J0L70S 0S0L7@04!4 0@T P `@ 00 0 Jh@*P7S @i@`PP 0T@0D<@000 @`! ON`7h76x;4\;j<7`*8 9t9'A-`M0Sp p!@PUE P1P@U'@T$ 80S0 0R40P

DP+ @T 80S 00Q @TЍ@

  t*Pm?  +P01 #Pw R @P "0 0"201PU .P}.P}8Ѝp> \2R00 0R0 P $20P2" # PP R_ P !0 0!10!00  1t!~o 0R0B Py  \1 0PP1$!jn30PS10140S10150S10160S101U000:@/@{l0lP;0h`085808$_0U`! =>4wD>=l==|>>@-@..@- M@ 0`Pp0P0  ` 0 ` 0 ЍooPO-,MP  1SQ t`plPW@1 :P0Sn pWZ pWA $0 @ X@|,Ѝp| v!00 1!d $t^$0  `1`\60P!PP0H!H< R5 P7,Ѝ 10p1 s R$ P 00p0 b R P 0 0\ 0P\0\<P0P(D0D`! ">4<7`*6`7h7@?&?>@-M@+ 0  0 Ѝ<@-MP@P =PPlE ^0T`S hp#Sw h#Sh `#Sv Xs R ]P R UPtT#0 0`p(1Sv lP>)@ `Q0# BRD,|2 R &P&ЍT *0 SЍT *T *T * /C BRq10P1!!0 0!1 0l!1 0t1`!pph!0 08!T1n~PP 4!?(!EScP}00 1Tl 0 0 0OW00Q|0 R P 0 0X 06@404pX0X L`! Yl?4hB'h76?zMb?u?@-@0P /A-HHpH`P@ pJ 0@U  Ap@-0M@`P,  0`嬱0P0Ѝp@-bM @RP| 2P<QK k:!Q) AQN`p00`p/Z```` %$00p00\o 0Qh  0  0Ѝ`!0  01!Q0S000@T0 P^ D`@) P0SB ~P  0%KP:8 0x50@Z cP0S XPw0%|$Ѝ$ R GPK ğ0 &0S h4 R -P 0X$XX0P$PD00 0`4$0 0# 4`' P \#0 0p#3`@F#008#3 z&8 #0 0#`3ly8`@(8#0 0 @$3"Z\`P"0$0x"2J 000 0"0 0 "25 \`@|"00!l2 &02> `@@ 1|x1 l`@@ 14 ` 1>0Sp00   `@@ 818}000000 0xq IP:80D@0 @4`~`00h`0Y{`! `"\|A/ @t DDH8E<7`*6`7h7D$DE%D-O0DLXDxDD[DWh l0p@-hPUl0P p@h0U P p0p@-@`P,  0` P 0p@DEL0p@-@`P, n 0` P 0p@DE0 0p\p 0/ -^ 000p@-, @PA0 P0p@DE00@-0MS :1S! Q@P"h h0R Ѝ00S* 0S6 $0JS0L70  0 0 R PP ` 0 0 P0 h% P`0P(L@0oQ<7`*6`7h7`! TEeA0p@-@`P 0 `P0p@DE0@-@ 00@ DEA-Ph`@ p0W ,1M@0h 7/ U h0Uh0U P Ѝ00Sh0U` PP$0 00S P h`0` U`PP0L  0 P<0< IЍ` P E`! EEEAO-@4M0#XPUYg#d`Vc$p% # $Z Ԅ R P0S wPu YT R lP 0 PğH !0  $V%PP] $ hP-( pU Qr R AP 0000 0`#00  0#3h# R $P t4ЍY P  n (i(0  2" Y"0 0" ={` ( I( 2 02\" |0ScP8L2  ^ S R  Rn P `!0 0!1R( `( 1t+l 1 0L!?6 /0 `0 01 j0 (0,, (0 0 0 ( 0( 00|  0 0T 0;0ph005`00H@0.9`! FA[%(%TFI`"\|F>FS$FE9O-PM0p#H`@TV``)# [%%$ #  씟 R P0S St$4##0Z4 0 0d 0l 0 0< \0`00TL0(9`! `A+0@B0GFFGDG#EO-@4M0#XPUXl#$ R`$ e$ % # (\ tZ P0S Pw ZUX P0 80$$ ,  -0 $$ P PP]( hP-( `U~ Qp R pP 0000 0`#00  0h#h3H# R SP 4ЍX GP  "0 0 <""0 0"2yl`yx20p2D" 0Sc4i02 ,D^ S R  Rh P `!0 0!1`@ 1`,X5 t1 0h10!h10 `0 00n ,,0 000 0x 0 0T _>1C0_l00=`00H@069`! FA%(%G`"\|lGG GE 04 08 /!80 SR !Q 1!#//90O-0MS^ :1S_ pl@h h0R h1 RF <P-:P7S8 811X! |(0@ `0 U[d R E@T` QU0H00LP0 Ѝ` 0 0 0:P7S `00H<0<004 440, , `! @HA<7`*6`7h7p@-@QMP 0S Ѝph h0R Ѝp`V l:'RGd0 R P `l 0 0\ \0A_h/ G`00 0 `! LHA9C-p@MPw`BV% d2YX {P90S S-0$"$咃( 2免 \ЍG?4 01SЍ0S) S>0PSU= 1N㓅( ㅍ1:|1t!xxppd`!008!P1 J?4 01p{p 0U0 ?0 R` P0P(9B PV :WP`00PX0, <0<&`! A!06((%xH:H.C-@PMR :1Sa q`lXP: P Q pWT P<`$0Q 0 Ꮋ00 :ЍC!0 00 2Q  0Q 0 *l 0 0` t0 0\ \H$ 808`! H(%HiA<7`*6Hn`7h70 0 ! <p@-@`z 0P 0 ` 0 p@bꈸ0SR@-/Q@- R  B QQ@- /p@-PU @  pp@-@ᰠ0$ 00DE@-/ DR /S@-@M :1S l0 0SЍ᧺00 SЍ0 g0 b<7`*6`7h70Sa O-@$MJSRR j1S lp,0SY l1SV 븢PS 0 8<  0(!*P 000AP00L "4Xn iPL00 0!$ЍOS 0CS$ЍOO" 10 1B$ЍQ Q !4|1PUK 7P 0L!0 00!<1 1 1?=  P0 0  l0@-0w ,0,#R`! zDA I$I<7`*6`7h7P 0!0@-@ MRP 0PU0 PЍ0S S:P 0(0Ѝ0@!. h0@ 0@T0T 6 0Ѝ0@Q! 00 0 `! hIA@--:P7S3 0@- MR@%  tP  R dP  Ѝ`l 0 0\ \0 R00 `00 0/`! IA70@-SM Ѝt0@ R 3P `L 0 0< u>Ѝ`00u 0 [`! IA0S /@-P@-  1S l@0 0 <7`*6`7h7P@- :AT 8,l@0  0  zD<7`*6`7h7p@-@M0S- :1S. P l`R- P 0 0(<4 :0 Ѝp@l0<" \ \0>0L LLJ0D D8E<200`! XIA<7`*6`7h7@- @P@k0 X /0 ` X/p@-@PhP Thp\J@-@{Pdĥ"@-@p\0\@$@-@e\0\@$@-@  0X0`@-@ p@- MP@`@:< 00\0 $0Ѝp`pJtJp@- @w `r Pm40@>$0$ 0T$@ZLN0p. 9p@- @U `P PK40@=$0$ 0T$@ZLN0p. 9p@-M @2 `-40@P=@0 AЍp. A- P p ` T0@=D D0@d$#L@P 0. 9K@-@  SP d4 , \(0(0 "`pJKA-M `@ P@P4 wP< lP @!1qT pԀ@p1@ T 0Q  Ѝ  T\P0 0TЍ $\ 0 0(Ѝ`pJhKKG,KHKp@-P @d ˇ0P $l@pp@$p@-P @J ᱇0P $l@|pp@$O- M P00<P-  1S, p`R@  l嬰\먐耄 R 0 @Q LT 0S   0 Ѝ Ѝ0( ((0. `pJ@$KKKK`7h76@- X0}<P  1S l0  0  . <7`*6`7h7@- X0Z<P  1S l0  0  . <7`*6`7h7/p@-P`@Vp \0 0p@`pJK/O-0M,,,pP@` T \0@ d 0S 0 0  TX0 S 0P  h R P|00dQ ЍXPL0` 0PH4 ( \000 ЍO@$pJ` L$L`LDL"|LO-88 M0" 0   "PBr`"0 `" 10  0!100`!(10  0!0100`!PL10  0d!X<1T!0`0x(F63Z0-n*'&$&!'#'P%x%% %% -% % ЍL@$*LP `X#PLLMhML|MM(  C-H MP@ \ H X 0 `0 `FDp`V` F0fn BQ0^ B XЍU@VO- f$M@PTpPT Pz@!Tb AT7 T R PI$Ѝ0S H0S00" R9 P@@`V P `P 5@(@5% :$ЍZI0 0L0H ӯP፯P J440S񟗼LDL<LLLL<LLLD00H H0S 000%1SH0S@@H`@_#00#> u0J 08c$c400z@! 000%1S"@ H"@P| 00L0H tH`00*00 3\B`"0 0>"IF`@@2 C9"0H  00P">0H  02" 0  0H L0峮0S 0 0 0L0H 墮00  RX P 44x!0 0u?H!N`00,01IHJP> 00L0H o600S! :1S" l01S l000%1S@ @LH0 lt0H 0X XX0P PD0(0u`! WVVVVV<7`*6`7h70SO-`,M{ 0@S{ 0 S @TT@@K+;###,0= 0@0S9 $pYPC;@T (P `@|;0@Pl;l+ \ @P @ <0 0@ <0001;C80 @ @ 0  _,Ѝ%0 I C &  Q)TTl$D8\Jꡁ(J* (p#, R )0@T7 P `@n0``P )0t0)?Axp) (p#| RX9@T P `@GP)0 0@89) ( " #,  BR|( " #, R P @0< 0R@0<p d8@T WP  h8@ 0@0 (X' " #, Rx0S񟗶@hdddd' (p#, Rb7Z|P@U@q P `P|'0 0P =4' ' " #, R<6@T P% |I Pn <@80#@A Q<@43 03< ( !0 R:4#22*04l0(&" #,  BR 6@T[ P%5  㘣#0Z< 3% 0X  0Pm ` $0^$0` 00 ?X%.Tꡁ(EK`BP 5 h P <80#@L\<@wڶ30<3& 001;C805t @ 2.\@ +>0 V( P <80#@L \!<@Aڶ3!0<3&! s3Z|P@U@ $P `P#0 0P3P# ` $ 0`0 0,c 0$ 0  $3 9 D0CD B80#L \0#0 S<# :1S l01Sz &l`@l"0 0@?" ]`@v,"0 0@2! L`@c00@ 1 `PV00P |1|T`@I00@ \1\ `P<0`p`  1 `*00 0o`P00P 0p&70 Pp0 a0x xx0p pd9`! WV@W A@F "XW2X$X\XW97|WLW"<7`*6`7h70SC-0M@Q @Ra  Ro PUUP PQ  Q<,#\ ͌ 0P0SP\ |1p`VE P+T }`P @ <0 0@ <0  1 ;C8 0@ 0  DЍ `` 0 0`?  YTP `m H0@P  9`! @W A@F XVC-M`pPP 0@!S AS S PЍ0S 00 `P`P00 R00lP 00  0ᡪPp@-MQM1000@p0D00P \ P_`PD ڍЍpYYp@-P U 8@`B @PP UPpXYC- {MX M`@C "0 0f(PpPm 2 10$ (  ,0 S  0 0 S0S 0E_>_.P feP 0&6{ލ Ѝpz.=00(PP0M?  S` N?m_HSX!! Rp q/ S 0'7{ލ Ѝ0 R) P  0  0p0 0 R {P  |0 0 l0`  0040440,0XY`! 8Z/|ZZU@-M @@"xP l0 R EP Ѝ@00@04  Ѝ0o`! Z|Z-M0 0"|P p0 R P ЍD 0 08 0 Ѝ0EZ`! Z|ZC-MM`0pPPH"p:04p?@Pi Q. "T 0p Xq010S 010S0S,ڍЍz.p%0 Q W~qHzUq010S n010S; _n\ `P0V0 R {P d0  0@0L  000(0 [XYT[`! ([|ZC- 4MP@  P@TPB$0hpW`@TApT T 0d"P@4Ѝ D2 1m (P 2 Rb PTAT1 S!8S3 AԑY  (@P011 RD P x!Pt1(0) ,*+ 0 -L!0 00,!q1S0 R3 P 0 0 0[00@0 R0x\t0(0)+*0-0, 0<0800$XYD0`! ]*`l[t[[|Z[[P@-MY  1SZ Ql@ $0R`hp2 wP X1X!XWpp0D! 0 p414!(P0 R3 SPЍЍ@0Wpp0x 0 0p n?Ѝ0P PP0H H<(0n\`! \\XY \|ZL\<7`*6`7h7@-M@0PЍ@t0 R PЍH 0 0< <0Ѝ0$XY`! t\|ZA-P`@Tp  P  0`004S`((@P@I`! ]x]|]]A-|P`@Tp  P0 Aw44@P@$&"! x]|]]]p@-t@tPL|Pp  P ?00p04 8<Sp! LHEFS@-qMMH@ 0 0 (0 0vPqݍЍLHEFS @-Pp@-qMMP  PA 41RA00CSA B~P30 S: 0@ "0!8#( @T P0 8#R'  A V%0& ## " $` #3` 0qݍЍpqݍЍpqݍЍpHEFS0@-qMM@  /PT h1R `Q  0PF0 RF   0  C %0 00 1& 002  03 @%0&$@0 "0 8#( Q\0 B0PqݍЍ0qݍЍ0qݍЍ0HEFS0@-QqMM@  P/ 0R/00CS-( I P!2 S&0 ,$0 "0!8#( P\0"8#R003 4C40 qݍЍ0qݍЍ0LHEFS0@-qMM@  yP< 1R P  0>P.0 R. "0040 000,$@3,0 "0,8#( Q^0 ( I2 PqݍЍ0qݍЍ0HEFSC-pd M@PT  0 4S S  ЍP?>>8=P$= =<\;OMc@3,04R ^# 0 "0 8#( Q ^08$#R=p0  p@EnPW0;t@9bDT000@+TX;pt0  p@CV ЍN@2,hbCN@1,`0@*|`OMb,,@3,04Rx\! 0 "0 8#( Q\08$#Ra=t000@PX0;t@DT000@X;tt000@V00 00 00 00 ЍN @2,|`M@1,`'0@*|`yD@T! +>vBO-qM,M@  P 4R S  0P2ST8C@`CC0=00?0001,'> 0@0 0i000Pc  0B=?@ P 0p M A0 P4?P` p90űš0PT0DA2P&P?%x2Pj :0 \bQO=?P0p   0 P4zP` p90űš0PT0app0q0P  ?4 P4WP` p90űšWP0L!0D\ 0 "0 8#( Q\ @L0 0Tqݍ,Ѝ0P0 0O=,00000003, 0=L00>0|00y?* 030> 00?0T00?2, 0'qݍ,ЍHEFSL>+BvC-Le MP@U@ 0 4S S  ЍP?HHHFP8|FTF0FTDQ\e]ttP8P0 4Q  ^$ 0 "0 8#( Q ^08$#R  0%   Č $ 0;@ `0@000@Y;d 000@W ЍQ^PC]sQj^!]PPpQ!^_|pExQ\f]bxb.P$P0 4Q\T"T 0 "0 8#( Q\08$#Rw 0% Č $ 0;@a p0@V 000@JsY;p0  p@9bV00 00 00 00 ЍQ^C]P P`Qk^^PP`i{Q_x_t|`FsPU! 3+r 32 2v1 10 0vO-qM$MP`@  P 4R t  0HP1SULL$MIV0 <.0004 0,d,4,$H`0 00  0!1P 0 0 0 0  `P?13P 1P`P?43P 10s? P` 0 P4Pp p90Ʊơ U`0bp0q@ P } q?4 P4oP` p90űšTP0" 0\ 0 "0 8#( Q\@L0 0 Tqݍ$ЍV2 ?0E? 0|F?|!NV0/ k>00> 0€i?L!AV0, >00,q? 0? !4qݍ$Ѝ1P0l0P0S =0E? 0|PF? (>00> 0i? @C= 00x? 0?| f=<4, $0 X 0HEFSLr+v301v2 0 1 2 3O-@MP@@pA`PF 0P0>UP ! #  @^U 0  0DPW@UW0Ѝl?d<\C00Ѝ<40500|]x]d! ]]]]`]]p@-$@P PPTPp! P0/,`0@-P M:a?@SJ1S+ l 0! 0CS!1 Ѝ0BP  0R+ S S SR Ѝ0RJ!R l !0 R R RJ1S l01  Ѝ0J1S l01  BR0!,``7h76Pd0Sp@-P{PP<@ `V00p/p! `p@- PHC@]@P P@p@! ` P0 0//~0@-@ MPPQ TM@D TG`S|SSSSSDTT,TLS$00 Ѝ0 AP8000000 04 8<0 04 8<0 04 8<0 0! 40"0# 40p@-@M`YPP TD@D T>TUUU0UPUUpUUT$`cЍp P `*P ``&&(&<` 0&&(&<` 0&&(&<` 0&4 `!0&4"`#0p@-P`@P UU UyP@1 bppppp@-@`PP TT T@y R !Cp@p@ @@p@-`M@P gP P   Lx0P Ѝp  I\`h! `@-@P 0! 40@-@P$00p0P d0P Q T0QP/P 0CP 4/00P(/$/ /xa`aa a0aHap@-PMc@P ?P`   g XxmЍp\`/@-A-@Pp`P 謹A-@Pp`sP0S 00 0b8bp@-@P`\P00p8b\1O-,MX`P@p: P@Po @i@ 0 `XS,ЍU O 00 C0p H= $,7$0  0C`! "Pb>@b 0A-S) :1S* l@PZ 0P`8 00p"0p  C0 4 0$ $$E0 @XY<7`*6`7h7/ 0A-S :1S lP@ 0 @p`00@8 00  0  X<7`*6`7h7 0p@-S :1S lP@ 0 `@ʾ 0 04 0p@d0  0  Y<7`*6`7h7 0A-S :1S! l@` pP 0 ᙾ0 0  08 010  0  $Y<7`*6`7h7p@- @Pݿpp 0@-@MQ; <  BൿPP3UP ! R= PPЍ00@T& P : 0 0 0X 0$ 0 0LPЍ00` ``U 40,ݿ0P0ֿP`! bbc8b6O-@DMTP[ T 3 R P2 `V`r@(P<0@80<@ 0< 0CZ0 SPY gPK 80#<L ^p-3 0[<3- [1 Rp 4PX1 ̾aā`  bpXW 80#<L ^D0CD B\弿*} @1BpApSWDЍ0PU P a 0 0 0 00| 0uZ 00T 0k@X00JW 40 `! bbPcXcb(7`c0cG-P(M@+%(ЍP b$0U P   <0AS  R P0 4403/,03/ (P($0Up% 夀` 0`R  B 岽 W$0S  8(Ѝ$0S08b6 O-\BMA(P`㝼pP-PJT  2 `啼 KpPI8@ᇼpP1Q@@ 㐽P101 `{1pPp6Ѝ1@TO P s\!0D0 PL1L!㐾Ѝ 1PU P!J\图 HЍ \哾0\0Ѝ匾00C@` 07x 0D0 @h0\ Tտ(P` $0$ b0`^c`! |cbc`A-QaTPp@p\J@\D̀d|@-A@0 8 TM 0$ D ЍPe" eG-QM@@ Q% 0R R2o \P `导 p嫼姼P 0 p`!ЍP!1^p `P@@0@`Pl! \TЍ 0 $Q$1$\P p`q1  !  0Pp`  ؾЍ\P `pZ     0P|  p徾hЍ\ P`? p4; 0P p`0 姾ePde" f00ee1#R-!<A$0^kPllllllllllllllllll,m,m,m,m,m m,m,m,m,m8lkk41 ,͌80SF P Pw 0 ,͌80S6 APQwR ,!̌,P Pw| ,!̌, @P\`wH ,!̌,A QPw  ,w!̌, Q90S S 0/0 00/0S S  00h/  /d0S S 0CP/  /0S S Co/  @o/ 0S@o/C0SA0S00 R000D0/@0D0/B0D0/A-skPowOpM@TT0 00 0A0C0B @ D p@-0MPSfoo8oHoXoo8oHo ЍpoЍp01(R@@  ) !@ % .T1AЍp0101(R8 R  R2 8S4A5P r 4ה01P  01  @ 01 @ j) 01)P >P M0 f &h06 0@-01M@0P R UPЍ0\00P@0L Ѝ0Ѝ00x`! hh 0@-01M@  Ѝ00P R  PЍ0^H00P@08 㫻Ѝ00F`! Dih01/p@-Zf< M Ѝp@:PlV0 R7  P 00`0  u0 00,Y I Ѝp<S 0 R  żP h 0 0T 0 U0 00,,0 0 `! ihi 0dS /0rS /P/01/A-Z~< M Ѝ7@dS p `* ΅ȓP=X1 R[  rP l10C?`! 0 00,o N Ѝ7rSp`g`Vpf0 R)  JP 0 0 A? ں<S 0 R  4P 0 0h p0 ĺ0 00,@0A4]000 X0C S`! ihii@-( 㑹P@ <0 0@ <0Lj0@-@M<W8P 00  0Ѝ0# Pj0@-PQM@80@ BQ(ڶ3U03B00@0B0B0B\' <0 0C0BЍ0@H80@ @ Rڶ3 @ 0@ 3 @x @#<ADD B0C8S00 00N#<ADlj8j6@-80@P`EPM@Dڶ3pE03@pp E00E E¹1QP`; x!(1`0V lPЍ@|0U`,弸(!0D0!0 Up嫸p 0兹#< @DPD B0CP00S 2PЍd00`0L 㽹 ,0V/ `! kAljj0-G-|QM@Tp<`H P#@@P`04! `0  }0S`( PV4 b JЍGЍ/@2 00 ^0 f00@d0` ] X0dD0 $0^ `! A(k`0@-PM@ (PK <80#P@L\@

101  #j 0-0 (F 0屶= x0x\夶0 @0D8囶DD B0C0`! kA%kkk8j67O-xM MX@P` 7P, Q8 <00C0C(Hη PKlQ 6S  $a2#( X"*1S? 7/ ލ Ѝӷ'0 0'?ᗶ Q0'堶7 PU P ᰷L70 ?$'tލ Ѝ夶J(7!0PP&媴P ?S- @00cR00S .R :"-0S )R Q QXx 㖷PL:T QL.P.1S =0S$1S . R :-T1S . R :H-0S (R :L-0S (R|1S ^/ R = b Q =0S $◵=!$$ |0S 'R XPU ?P8- 4xo0*@=D=D1S - R :--lQ 6S $([""44:t0S' 'R$ :-00Y00 !<$AQ @Q 夶P_ s;[㇯0Yl3$ 083$@յP43/Xt ˶PA ᔶ"0 0"2X4R 0 C<R*TL>QP>!PU\ 㪶Pj s00l2l" ,"7]L僳ipWU ㍶PM V 2囓#=!$0  0!18 :M-P w5 X18埴+l10d1$ ,1,叴 1 冴 !0 0 1ִ0囓#= $00 0\h 08_ p0pV`! @$ llA8j6\l|lllR4lmPml nDmlG-MpMWP@` PM QY <00C0C凵 Pp,尴pVC, 0@Ps\,嶲1,pS - R 0p0W0 㺵P;p(1T( DQ% Yj @T 㨵PU#ލЍk"0 0"F>/ Q0l"ll80d4 D2PwP{G $2 0=! 1/YdލЍ. 1F噳kBjQލЍ!0 0T!t1߳0 ჳ!" * Z㰪10:  1 @T* *P# 0Zt00 0xOW۴ 0 0 0L 㞳ʹ P0P7`! @$ nn`nA8j6nnnoDodop@-@P00po@-@@ \P @ <0 0@ <0 @4 Ljsˀ0@-@M@0-0\ A RL\4ȔȔ0 Qʀ *1l;4|>04 08Ѝ0-@T Q 04!R01001Ѝ01S  ʃ!l+0*1l;Ѝ01S  01Ѝ00P@T aP  @\ 00P P0  PP 0僲 `! oAO-Y0MYMp@` 0PK QW <0 0C0CxdzP0S ȳPI PUn P ڳ$)0 0)9㞲ލЍ0SY PU P ẳ(0 0(8~᭳(0 0`(p8q Q0P(PPz R- Q* ^' Q$ L\^ Q[QiPU 㴳P- }007' 'A p x7|p۱PU, 㖳P _d'0  0L7'ލЍI 6崱F6/`kk7<0 6|垱PU YP "0|&0 t6 0S GP 0<&0 46H 0J JI  0$ S 0 5a0ᙱ  ᆲ0  0p/PS000S (R$2Sk ". Rg 0@ A00S 0@ 0R 堲P PU  P Ჲ0@0 0 4`$q 徯ᚲ \4\Aᑲ (4 8PU 㷲P ဲ40 4#D ᑯkl3 `װA0S0S ㏲P XA0S@``l#00 `\3"H0S 0S pPs0SS hP 2 "228 0\2@LPTPPE ᝱PG P Q: yP6 PUg 8P P4"0 0P 2!㿰 y 1\Vm1 DPܱA0S@``|`t1 p>0 d1IJ   = ㈰}I J00 1 q᫱0@ 0  0Lឱ`B`  0`! @$ pA$qFo8j64p@p*op/p78qqqtDrHqR|qPr}qbqtr0- MR ᕱP d 0 0P0P %LL]H@Z@4W Ѝ0帯`! rAt@$ \0@- P@ 0P@ 0Q@-@M? Q5 +Q   Q0S0S<T 00ЍQ 0ЍKPT 00T00ЍQ8P <Ѝ0SX0@ )P   R(0 ! M/ t0/ O-P!MPUMX @p`W P=<0 pPi  Q <00C0CT@↰PH?aV >ⰠZ (?/ R!ݍЍ N@P @ <0 0@ <000CS0$00 0 P00CS񟗭h@h,Xhhhhhthhdh@hhhhhHhhhhܭhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhȰP&< 3 B0C< 3PU Pb80@ BQڶ3B03@B Y`3:80@ PAP ڶ3A03@ Aᾯ80@ BQڶ3B03 D0@BB0B 1P@T 㽯P <ၯ:0:*F00C?o2P0S0\*!$0!<$00P, 0$* 0P ?D*@T }P F90p9) <k!ݍЍ5 t9t 堭l^(X 帬(0 D9t 呭X00)00 #<AD0CD B0S90:,!80#!<LN\Eڶ3.03 0< 02 ?o2R0SH0S 80#<AQJڶ3 030< 00S80#<@ʌP"0ڶ3 030< 0Q80#< @Pڶ30 <3- 80#<Q @aPڶ3-\0 "P3< 80#<Q @aPڶ3 0U3< 0S80#<@ʌPڶ3 03#0< 080#<@Pڶ30$ 3< 80#<AQ ڶ3 03< 0Su80#<L\ڶ3 03< 0 0 ⤬r0SZ80#<@ʌPڶ3 030< 0\QD80#<N^Phڶ30% 3< 80#< @ZPHڶ3 03< 70S80#<Q @aPOڶ3 03*0< 0 ?o2R0SH0S 80#<AQIڶ3 030< 00S80#<@͌PEڶ303,$+0< 0 $?o2R0S80#<L\ڶ3 03-0< 0 ?o2R0S80#<@PDڶ3 03@0< 080#<AQpڶ30A <3 80#0 D0D Hp0  00 @0 , 00D0D B(`wQ@-@M< Q2 #Q   Q%0S0S:T 00ЍQ 0ЍMPT00ЍQAP<T 000S\0@ -P   R,0 ! $M/ t0/ O-sM` MV@P P5 QA <0`0C0C(``x啨P;LYF $0 0~P 0vP @ To @T ШPH 0 ލ Ѝᑨ"0 0"2U Q0"^pW{ 㫨Pލ Ѝ`Vv 㝨P f420= "+W10`1PPܥ @إ10P @`1! : h1l`奦ipWB `P )PD嵥H10P`<1!  ލ Ѝ$D{`圥 P嘥`P 0qc 0lh h0H_vPLwP H0HQ`! @$ sA8j60ttt`tD7G-pMW@`P P+ Q7 <0 0C0C卧P1 0{pP3 0 sPP, 0S1 S S  PލᓧX&0 0L&L6W Q0,&,,`0 JP 6/Pލ4S O. R0`0%R <0S011040P0Q Q>0S ĥ!"442<5S S. R # # # # $ $ $ $04dQ V>0S0T0P#T #0T ST0:T00 R#T  0T SlY V>00S5S - R0Y04  03@P@-E BOP@ᕥ Ⴆ@ލ Qf <00Sa D!"442$Q R>0S,Q R>00 Sw 3  02@ڥPDP᫦ 2Q Q>00S !"4434X S>0SP X ;00 S T2  02@妥P ۦPPލ! ʦPy 4  6Τ ʤZM )ZI;00SD 0;3 ⺤ ⵤ 4ۣ ֣ ᴓᴛ⥤1; ⟤00 ♤13 ⒤!"4410 4!"441040X0 *|APR괛ᴓ tu`! @$ tA8j6ttt^O-P$ $0PU eP .$0 0 4d$QލЍ0T$TT`PT 4Qp  ,⃣<Qn  *}2#TTX%X\4SWE  ,d 똀F 3 Rw `P44S <4S \4Sv ލЍX帣0P#0h 0 0",3`喣$ ĤPA P$ 2z''20S| P` ,壡 2 0 Pp2H"`ilRᖤ00 (2(i`8 #4<`4#,0x 2 10 0hp20p1|`ܢ80#<@P;ڶ30z 3< x80#<@PD+ڶ303%$~0<P 0a80#<AQ"ڶ3 030< ,0 㬢L,,0 0  0`l噢L t2@@q 1ܠc@0 @^ 0 0 0"Q 0Z\张H p0p8峠`! v8x8 96jvwxPw AvTuvwwxw A-P@p`SP ⎠P00  ᆠ0 0†0 0 z0U0 U p00 h0 0 b 00 [00 U00 O0 0 p@-@P H01ZP A0040 00$0C 00p/   /0! % ,R 0@-PP.\M  \$  R J = LĠ S̈́ 0 R 㱡P h0- X X0AЍ0D@aB0՟YxXx`! 4z\zgfffO-P@ ʟp00 (P`  ༟` 00  P  P P  P  P  㔟00` ኟ00`圞tx嘞xC-! Mp@Pe /1,0 ( -<,@`0@Z0 *,q= =m pT 0 `HD㳍 卝0 ` }  p偝0 0 `  p0 @p$ "  ;P0( : ,!㶠P  ЍP0P PPpH@᪝dz0P/   tz  |zxy%\zz6z00S (P 0Q/P/=G-0Jp<==} PP )0[ ==- W>-/~ d`Ḡ& 僥 p?p>M K/2t@-D-名呍nP -P>   1e랟P Ӟ Ϟ ˞ Ǟ Þ 忞 廞 州?0(>8P@a(嘡 R/ m$0d?h? [Pp* <`|oo QP% =.\40 P^==^ ^//,P!p#00>\ \\X0H THzL04 H4u yz0j/ @, y \zz6zz0@- MR@ 㬟P d 0 0X o?<,1D  00 ㎞Ѝ@&0o ϝ`! z\zQ@-.P l 0 R 0S D0000P@/L b! CYxXxgfffC-Z= A1//^/. ,/0@-0M)S@P)(S * CR 尝P Ѝ0娝P0S )S 7S7 S0S; !S 哝@oЍ0 CR初P S S S PU$ ɝP  0@  0@0 U(S0S !S S      0 0 ݛ`! t{s\z0 S S S /}S :S/0S0S QS XS PS@o/(1*,! R :--  R !<,0 s; Q  R? P/0" /</O-PMp(x2P @T ?P^EЍW)@'`Vf 0PO {Km隈: M*` j!sKOsk To4 P P PFp0SF@TW P "d10 pX1X! ᓛ410,1 ! ᅛ^Ѝ3.4ZS0.4`W0 00 p@? h W000p 0d P0P@^vp 0k`! {\z{KK4|p@-@((PPP8` မ(PP P Ԛ0 0p0/ O-t! M/@PU `@y(0T!(0,00 @ l 0P$pt`  00 0S0 `  j⊚ P圀0  :0|MB 忘 B0  P UMo Ѝ$  ,L 8p@-P\P [0\04P U040MZ@_`P J`sKOTpO-!lp$`  ᢙP pB@D80 SACԱa! wOP80  P_MU@pskWof0$ $$wu0 rH`l6xO-mtp p8`Y s[@P @<P P<0S^ D RW ?   ?   ""  0007S y. R$d0S                           "" 0007S z. R0`P$Q \ "  Rp     "R  \  ;^7S y \ ,  *  +  "R ,  \ 0   < :;P< \ Ѕ @ą L JKPL \ Ѕ Pą \ Z[P\ \ Ѕ `ą l j k Pl \ Ѕ pą |  z { P| P0 0Ӆ0ąۍЍp`  &   '   (   )   6   7   8   9   F  G  H  I  V  W   X   Y   f   g   h   i   v   w   x 00y0 $  %  4  5  D  E  T  U  d e t 0u0 <; (ۍЍD0S@-$MP `@P 0S$Ѝ1pW+ XP@$Ѝ00S) LP 00 `P@0 ۔00` Pt0h  @ ˔`D0 @@,c`0 \`! ćRQ/@-P0M0@p`ᶕP 02SЍ R PO0^00`000T2 0 <0< y`0 0`! ĉVćp@-=``\ 0Sp0@00PkP0 0@9p pdp9<40 S 0S/0p@-0@0PKP  :4 4) 4)ppdpRQ@- 00E00 0B00C0p0 B CEp@-@RMP 0AS" "@Tl aPdЍp`@嵒11! dЍpAQ Ѝp k$` TP!0` SZ04@1`V -P$ k@U$` `@倒@ 1Z0 R, Pg 0`  0 㣓g``_00`@0t  ᓓL`PPP <0<8*d`00 (0("g`! \<mć bpup@-@MPYP) @ 80<`NV@<ڶ3`0330@`P0000Ѝp@a#D @D B0CS Ѝp_lj@-M`p@Z4P0PE @<W@< 80#p@P,ڶ3 030< p0@80 @Rڶ3@03 0@`@P@ @0@000Ѝ@#< @DD B 0C8D0CD B Ѝ蔊_lj7A-M@PY1 R`J :P4弑Pd @80#ppGW@<嶃@ 0<0p 0s  080@ TBM@J@\7ڶ3B030@@BB`B0B0 P00ЍA豲 T00 ` 00 ㎒`0T0 0$DpD B 0Cd剒#< @DD B 0C0{ Ѝ`! _ ć7lj0C-0MPp Y 2@T`S 㯓P;1@Pr @<80#<@ Iq\Cڶ3 03< 80@ BQ@ڶ3B03"0@B`BB0B000PЍC@00 @0   0厑D0CD B`#<AD0CD B( Ѝ`! _̊ć7ljA-dBSpM`P Z Ri P@0SI P.  喐P{ @80#@@DT@<嶃Q < 0# p080@ B\Lڶ3@B03+0@@BPBB0B`ЍA葱X!00L!L1u<1`  !>k0Sp0 R, P 00P0 Q`000D@D B 0CR#< @DD B 0CLD404 Аv Ѝ`! _ćs Gr 7lj0p@-`P@W0 p@LA-lBSpM`P [ Rj iPA0SJ aP/P} <80#@@@DT<@Rڶ3 @0 3<@ p 80@ B\Mڶ3@B03#0@@BPBB0B`ЍAݰ\!00P!P1@1`  $!,1㷐0Sp1 QR-  P 00P0 㝐`0009@D0CD B坐#< @DD B 0CP叐808 t Ѝ`! _ ćZGWY7lj0p@-`P@0W0 p@IßG-MP`p0P 㳑PU  R <00C0V0W0 8 #P:`$@P 8<8##8@L\<@ڶ# # U<  Qt <00CS80#<L\tڶ3 030< 0V 80#<AQ_ڶ3 030< 0W 80#<@P}ڶ30 3< U Q4 < 80S B< N\Pʶ3& 0R 3<  j80@ BQEڶ3B@03BBЍG41 ,!,1㧏UZ0^0!小 0;JDD B0Cត0 噏00D0D B0J厏DD E#<AD0CD BDy Ѝ`! Pć8 967*xlj 0@-0 M0S@ # S  @0dP Ѝ0~S 0!S )S0d lP0 @dPS0@ dP0d PC-@MT8 <0P0CS`000S& "pP; 0Sc0S] 2XN ZP ☎ႏ@P8Ѝ L2LH傎@Ѝ0("((`嬏"00!2 ǎ1`V $P 喏10p1!㲎000 aM`偏 d1dHBR$1X5 P `pj!00 1 ㅎ0 bP"6@0 R ُP 0 0k0 oP@v`p9p L0L(<0<`! 8ć8 96Hԋ>+ A-RM`G <0P@p0CPPt=P0S= tP: T!RP@@ >@T@j0 0Ap0 _eލ0`V- qP@ 0oލ 0 0P0 0 @ 0d`0` 7c$00 0z<`! T,'ć8j6P A-RM`I <0p@P0Cpp`ƎP\1S? d\< !R   B/o`1"劎Pލ0X. P@ 0o6ލ@ 0h.ލ 0 0p0 |0h hh刍@ 0d$00 0<`! h,Mć8j6 O-RM M`h <0P@p0C8PP,UP#0S4 4Xb ᣎP #3 0P:>#/@ 0hPލ Ѝ3XT ႎP!@ 0oPލ Ѝ1S& r/ R" 0SE S0Q >0SJcP{"2 0P2"0"@ 0dP`t20 l2:dw0@ hpPM(20 (2(dQ >0S @ 0eVPP1!L@1!P Pr:=-L S k tpPM @ sk@0D0CS0S M@ Ts⇏ XOp0WPK?S 0  ㈍8#<0P@P0ڶ# # <    pۍD0LD B0Q<`! lć,8j6p7 A-RM` <0P@p0CPP,PEdP >pJWd2} R| tPD< Z ލX` aPH G1-d:!? 1c!cQ00==0#=`!d1 \ލh1`VD 7P@ 0omލ810p?(!A!1 0P1 ᲋>d00P0 ᤋ0 尋 0|9l0h4X00 P0P<)0@ d"<`! $Ić,̌8j6 O-RM M p` <0P@0CPPgP@<0S4 #R1 I0 SP0 0(1V ATi =0j F/ R0y01Y P09(Y 2@T ㍌POލ Ѝ@ 0dލ Ѝ2 RN wP$@ 0oލ Ѝ@2 R` eP ` 2 0P 2 "@ 0Oލ Ѝ1 01`  0P1!ߊ0!H0Y090@ 1`  0@1\!ȊL10`00D<10a;P 1 R6 P 1`  0㦊h:`000?Po _p@ 0 hO1p0F0SP1AP`00@X0 T"``00D<0<`! 2 ć,) 8j6Xa ,R  C-RMM ps <0P@0CPP@aP<LQ0 l0S- $0S* H CP_$0l`@ ``FVn@ 30C`3@` 0 ؊1 RL ᎋP.ẊލЍ @0dލЍ@1 R< uP @0oލЍ0 00`  0P0 $0 00`  0P0 0 0@ h$00`00h`0Xz@00`008004q 0,؉<`! Ć,* ća 8j6kG- ` 0R0Mp <0P@0C PP,岊PY0SE (RB   zR㉨ PiPZW:  =(0*  .F/ R0c075P10@Z R ӊP @80P8 0(2`  "2]  @0dލU88ᜮލ1 RM ᩊP @0oލ1 01`  0Pl1X!.0X!XX: P1`  0P<1! P R0 vP ` 0 0P0 h`000坈f00`00xp0`唈8 0P80`008,0,凈`00D<0倈<`! ć Ԇ, 8j6 ԍ G-sM`@VP &PN RZ <0`0C``X忉PU1S @#`> RhY P0hP 9 aV "B? R:`V Pf0 hP dĆ`ލD20@"<2 d R0"npWn ỉP'0P o`ލ  `P⻍ P 卆 P=0P l~aX!X1 0`L1$! 1庇V101  000  _~ 0l嗇uu 0H厇MlP00 H0H僇`! <x@ć48j6l,7ԍY,G O-RMMp <0P@`0C0PPĈP*$1S t(P00U RP9@8 R  P $80P ?(㕇@ 0h2ލЍ7pWJ P@ 0o ލЍ'7 0P7x'mlQU< hQHU[k ĈPP[W 㻈PY YHl1$ 0 ,0 0$0( 451YS Rx 㚈P 6 5! d&t6)415Y:YSI RW えP 0051 0 64! % 6 v0%>s# M?0+Ӆ l奆0!0)0I0! S!|GhGxJ0GEEEEEEhGL%01P 9U01> CP,Y  Y Y  W cލЍ01@3=0 +㔅 lf01001 0S0(18<9S P 0(1)B;vLY   WP46EA@ R P 51 034! #?{ 93(@?t#P k oN@$ Pڱ 8 bv*  xWH@J  mWy  30 P3" >20 2օ@ d@T? >s#0!)M?H00!+ T 1 #2@T0 uP; ̈́$20P2!. P 1嚅 嵄P 1 P\包x1D内L h塄 p1p|`a@c +㥄4 `lt017010c)0]   ∄  V n00@0P ᣅ ha |0|<@<8`! ć,N@v8j6l$iG-M@pPBL2@@Y` φPoQP @0<0X@00<'80#L\tڶ30 3<p 80@ BPmڶ3B03~0@@BB`B0B000ЍGE80#NPdڶ30 3< 80#<N^<=ڶ3,,,$03< 岄80#<( N^ %ڶ3 03 0< 0<`I00  `; 0僄vD0CD Bh#< @DD B 0C4ل Ѝ`! _8a ć7lj80#<0@- N^,M@ڶ3P0  3$#R`PmTQ P mPr?!_Pt/Pn/Ph*495i00 I@2 R@l 㯃P]1P4 @ 80<pNW@$Ҁh8D0*01M-\P 0T01c {;s;A@0C R D%@% @%=0Ss;Q@T\3@T P{8 2!ݍ Ѝ,0s⇏XO~40< 040So00@T P DB 2 02" t@( @+? X$h&00 0 0\20`T20"Ve$ 00 00 2V0!S@100@1$~@ 1 0@1l! &D`~t10l14! u$(~@ 00 @100 0C01 ;01+~ |000P d\Dp~ 00 `0`@;D@~ T0Tw1<8`! >ć<,<`$$Vؐ8j6LjO- @ 0M0RM`O <0pP0C pp巀P0SF 4 R) P ` 4 0p4$ P0O1ލЍ4 R P P0oލЍ`00D<4@84 044`  0p 4$f0 $  r1S #00Y R P0hލЍ }p5 |PUP  WV⸧ ZcD30\% 0\%  +} ~M |.}`5P  0`PU yPZ2 Rd nP 2`  0p2h"~\20`00TL2@~o("\5` 7V\5u LP $`@}202@P !~F10 RL 2P00 }10 1d! ~l`@u}t1PPh1 PdK`00 1C~K\5 ;\5+ l}  =~00i`@N}@0 (~ A} 0H~=``@2}@T0 P ~<`! tw ćP,r 8j68 $ܑ ؐ O- @p 0pS B#Mo`RMA R <00C@P_ R P?DQ  !=0S0 0L8S" !- R 0Q4$0 sP >$  />~ R#ݍЍ0$0d8(0S 0Sn TPTX 0S| IP0S: APY 0SY 6PܣZ ?0ST䳝[ >>0S:0pS00 XY00T(R  Q"",4 [ 00 00P@,0S R* ~P ,00$= ``  - =}0 O #ݍЍ0S ~P <  \-<s}0S ~P <  -p<a} R ~P D< ``  ,,<N}0 d#ݍЍ; R ~P ; 0;`  0;P,1}0 o#ݍЍ;  ,; }O|;  +h;}2(0 P; +D; } 0$ SR000G @|0@ S  \~P {: @+:| `:`  0>+|: *:|0Z:q oV0 0pS L`V R3 (~P ` $: 0`:h*|0 /60) |``009 H|y9  B| R }P ` 9 0`|9)|00 8 '|(0 009t |00 8T |00 84 |00 8 |4( ,(8W|``004,8{ p8 l{0 7{E70`007d{XؠPw 0S$0S<0 0 24 0RN0XC \0PF0 }(0S0I0[0H0H`B8&h8(pV#4Ц<[h#p a}P< b8"#4<QbT# T}PzP> <80#*P@ HX {Vy#0  0$3{/`Fy3$ 3# {`00h`3zN0y40 X3Xxz `$y4 0 ,3,Dz80#<L\Gկڶ3 030< 0LY \0PG0 K|80#< @Pӓڶ303c 0< 0M0010S  |P ` <2 0 ,24"z 0$ SR6 BPE00Ú`8 #4<`4#@0?`00h`1/z#< @DD B 0Cdz0Sd  {P ` H1 0 818!kz0< 0@00t<0YxPP00@< <xPE<`! @     h, x d T 0 ` 1 8j6$  _7| T lj\- 8  ć`00 (0( y]`00 @0@@yUi@P0 0//@P/R 0P 0\ 0R// 0 110 020/03O- MR 9{PxPP <80#@ @P<@ڶ30 <3 80#< AQڶ3 03<t`# ssko V@ 1S1S}s"p@@(S ^@80#<L\]ڶ3 0< 380#<AL\Mڶ3 03< @}Qp 0S 0S:S0S RD <00C0C080@ BQڶ3B@03BBЍOY0 0?yk#<AD0CD BAy0xWD0CD B\1y08 88%y Ѝ`! ]pćlj78j6C-PM@  wPA @ 8p<`0LS@x Ѝ_7ljG-`MPLLp w@PK @ 8< 0AS0@<0*ڶ@o! #NX#0+ W<0p  U  w(10ЍGv#0AD030D B0L4wD0@D B0Lw Ѝ_lj7 A-RMpx <0`@P0C``xP=l1Sn 0 : xCwZ?0l S`3@" :=- QČ0Q * Rd!P 0S Z\ | uЍpQЍp@pЍp@a8V`00  0 $0 gauЍp`! ć O- PMRM <0p@0CPppvPZl`V `?oZ2L58 ?@T vP) `@l;t?0@ph?h/ u`Fp`00WL5 ? R vP ` ? 0p>.cu ލЍ1S10$ RU >@T vP!ލЍd> R vPoލЍ04>0,>. ,u> 0>`  0p=-u0- +u= R wvP ` = 0`=x-udލЍ,0S0 S V O P@PfO0| :P_?\#PXQ Pf0F800SOyt0Sh 'Re 0D x< R *vP <`  L,<tONk ``:` < OtG᣶ < FtT;0`00; =tZ`00; 6t.`00; /tO< 00(R H+z 19R09 uP 09 0X;`  +D;it w0S +R : ((J1S . R :'LQ R? Rv: 'TQ > R: (1$0SC R, (pS 0D0<@`4@D:  Y ,*S04@ @0hh Tr`o N VVN@v X d9[ euP\5 f0\e +r s$0( p0W],0Z:0<@`D4@<"Px R 6uP0 S 80S0 0S ;S 1S >000d0J057/GPZ6/aPT49 5) 80059 00CS(3kZ< :PPcH\5 ;\5+ `r  1s0S )R *P0Q7:r70 p7' ksl6 R tPZ 47`  & 7XsPr 6 rK10CSW,,,,,,        ,,,,,,,,u00Y% tP 0R! `VO {tP=0S:SSw;`V jtP᎚PZ7SG 54%Ts0u0u0tt R ItP0 5 $5r0 $q (RP 4 R -tP 5`  X$5rhQn 7Pr 4 R tP 4`  #4r30 4@RG sPv 84`  0`4#rjp30 4@R  sP_ 3`  <#3vrU @0h@u c`30X3" _r=50oPa[`002qC@TJ sP :@ 334" 3rZ 50SZ`PRJ`P; `V sP h20\2! r>Ps @ 0  18q` ( pp$p$ 1 (  0 `h1  qγ10 1  q 0`dq0`000@\qNF R013`00TL0Qq<`! ćD,8j6ĕl8P$ؐH$ĖؖE ;T\[,ԍ$}ԗućht00|0(  dq_`000Pq<T 0tpO`000p+`0, (0>p$pp$00(00 `, 414pa@T> rP !@<10 P@X1H!q`001tpU`001pN1p0 1p`в` 2pP$2 8,p@T& DrPG ղp20`x2p"pY /rP 20 `2" pᲲ2 Upeᨲ` $3$(JpA-MpPo71 R`A qP1xxoPV <80#@@@DT<@1ڶ3 @0 3<@ p 80@ B\,ڶ3@B03$0@@B`BB0B000ЍAx0`  p0 [p`0|0o@D0CD B\[p#< @DD B 0C(Mp Ѝ`! _0ć7ljO-@MPp`P_ qPH oPi 80P#<@崰JX㩡p q7ڶ3 0< 3 ` p80#< N^$ڶ3 030< P080@ B\'ڶ3PB03 w0@PBBB0B@ЍO0 0oD0CD Bto \0`Xdo#< @DD B 0C(o Ѝ`! _`ć7ljG-M`PpPm n@PC @0< 0 @00< ^680@ BQ8ڶB@! BBBB#<PISYP0 -0V< P0(10ЍGx80#<@P#ڶ30. 3< Ѝ#<AD0CD B\UoDD B 0C<LoD0CD BBoꔊ_lj7T2A-@MTP` Q@@pPOn@P~ <80#@(pN^!tDP =8P 1<" !1k 0>.(",$  8#eP9P5 R gP 0 0`9`  )L9=fP49  ) 90f9x eSP P 0`qf88() fi 0 0&eD80 48( e`f 7e7 R  PgP 7 `(7e0 o@dPP,P,7`V 0gPi d 70p7]6`V !gPZ f6087N47  ' 7e. R gP 0 06`  ,'6e5PspW fP 0`p^f6|6 & ye PW,PR0 6t e 0 06`  H&6\eT50S fPo 5 &5Keg5 R fP^ 5 %5:eV40S fP X5 |%L5)ecP 0`005Dd0Sh R  xfPHX  90P0 pW gfP 4$HX`PѦ4(t4$ d_PVe 3Td3@d+PCe <3qdmc 3hdd 0`e t3t]dN 0`00H@3TdHX :9 0`peD383"@38HX  `20 0x2x/d 0`be 2#d 0`00802dp2 ldFP2Pd42 0h d)60Z HXwPU PK/* h1hc1!HX`P  1cFOP(tHXh100* 0@ 001@! d HX)0 0cp`! _t1`*628 9c8P  LPQ(7ؠܞw "@N  \ ćy<P, B0Pj R $eP T0T HX`0h  0 x0x cP0`HX0?c&P< 0%R 'R & /  / $P /0 :a//0:a/(00/ 0oQnQ R: //fQfQ R://0 :$./0:$/0 :%./0:%/0) :[--/0 :-/0: /O-# p`s[8K @杉M Y@ 0S 00CS 6/@TswOM@Y 0S 00CSM@6/Y[ 0 :eR  ///0:/0@- P@4U00 M 0N0b Ѝ0`pJ 0\ @- b`pJ G-LbL\0M @P 2 8pb 0 S0 0  1b 0S 0 0pp0 1 b 0 S `0p 0 x1pp`b\1 db0SC  P1 0 }b  Q000 0nbЍ 0Q  ЍGbb 0P  Zb h0P\  Qb D0P8 h Hb  0Q  @ЍG=bpJ`P$LtDX0tG-p R 0`Rb  SM00@ 0 2b 0 S00 dX2  b 0 S00 <,2 a 2R    a0 0 1 1R    a00 1 Z_ R  t1  a1$  @1 R   T aH14  1 R    a1D  0 R    a0T  0 R    a0d  0 SP40xPat \0ЍpJ`P<`hȦ$0\hȧ@-@ aM@-@ aJ@-@ aJ@- `0P p@-@ P` ``:>`pp@-@P `U: .p@-@ `J@-@ `J p@-@ P`J  `  ` p@-@ `M@-@ `M@-@ `J@-@ `J@-@ `J@-@ v`J@-@ l`J@-@ b`@-@`J0 MPp> R`<<0<d` ^ 0 0` ЍpJ`Ч@- MP `p5` @0`T \0e` Ѝ |\x0 0pW` Ѝ  D\@00@J` ЍHz~$H@ @ Ѝ`pJdp@-@ _PjP jp \0 0!`p`pJ$@- @_0dS0BS0S?mS0S @-@J@-@J@-@p@-M@ _`PYj0P % 0 Ѝp]j0P (0P$ 0_`pJ@O-鰐尀尠P ipP" 0 S 00_މ@ 0 S 00_ԉT j@ `P[pJ`hp@- @H_PbiP  $0 0p0hiPp/ @- M@-_l0 00S T\PD`_Ѝ&  0 0Ѝ/ `pJtA- P@_ p_0 `@^׿P  0Q  |,_$P P\L0 0D_ $\ 0 0_/ `pJA- pP^1垿@P1 P0oS0mS 0lS`VJL>TnP>@``P 0QJ TP΄ t^ ^J`0T>P ,\(0 0 `^/ d`pJpH@-0@oS t `PJ0?0fS nS0SJ0?0fS0SJ?谪p@-@PJR__P_ 0?p踪@-@_0:o&Īp@- P@+^`000 R L\H0 0<_^p$0 ⒤p/ `pJH̪@- MP @p^h`P ]h0P! T`V+ `@ \0 &^ Ѝ h\d0 0\^ Ѝ 8\4 , ^ Ѝh`pJ,p@-@ ]P:-R \00]p C`P  '0` 0p`P ` \0 0]p`pJ\p@-@PJP 8[ 0 S/ S  ]p褫pJ`p@-@PJP 8[ 0 S/ S  ]pԫpJ`A-`RZpPpP@ D[\ 0S $S  {]pJ`@-@ \MC-PM p@]Yp` ]pFq[Jm[880 \0 C]Ѝ`pJtJ @-*N \% @-*N \G-pN.\PT `@T j^P \0 0]p [@P [P > N0P@000 00\,0 (\pJ`tĬ̬6ܬ@-P M@?\`D~[pZ 0 \,0 \ Ѝ`pJG-0P qaQM 0@\ 0R S00h\  0QB@\ - 0 $$Q  S00\!0R - 0 Q  S00s\ !0?k\  0P  S00t\\lY\Hw 0S00 DЍGL\pJ`Pt(ԭ$@44Hl0A- MP@` pD0 `x(\0S \0PX X \L\$ЍA6,0 ( (  \ꈮ`pJ$00eO-pRP @[`00 R1 L\H2 0<[ 00S Ⴜ=Sp5!L $@osKOV=pS00 S`WA x[=S L\H1 0@[W` _[P0 \0 0[ c#!$PP !Lj$@osKOCVP =Sp!L $@osKO,T=pS/ `pJHȮA-@YPZUU"P` bZpP @ET@  ]Z Z<lY(0( ((%[$0  [ Ĭ6 p@-PY@ZTTPP &ZP 0`D @%Z Zpp808 88Z40$ 0$Z( Yl Ĭ6m  p@-P8\@P00  0 `S L0VH  @ZpV $Z0J1p,pJ`4 0\ @- Z`pJp@-P@`&\0P0p \0 0Zp`pJ C-鄀 M*N.l`Vp! P[PP@TU P t00 l0Z ``0 TX Ѝ 8\40 0 (]Z ЍĬ 4pJ`@0S S/p@-0P @P ` l0p@> R #4QppX 8^(0\ 8 X090 x8W8S LxLR  |W 0 S00 \8 W 00 R0A  0C0 7 W8S 7Rp pW- 0\ ' \PpL70 0 D7W0KU0FU8 P7pW7S vԆR  W7S 6Rp pW-( 0O hfhvR  `6  rW@9 p R#20`H 6pdW fvR  5 H XW@9  R`5` LW D9P% S 5 >W hehuR  \5  2W @9R`` $5&W F9P$ S\\ 4 W dtR  <4  W @9R` 4`W E9pPd$ S `4 V49B ,d,tR  $4  V 49R  0 0 3`V4) 0PP#  S00 43 V4) 0@ S000t3 V498+ 0S``@3 VЍR`` 3|VRR`2` V1tV= QV 1R`0H2 ~VЍ0(uV1)pVwLBU M7Rp 0aV+c#  c oTI 4 TVL0 S1W P0N hHVc#  c VT$4@ ;VL0 SXP17 P0M /V $4$$Q% !0 0V24S p00& T '^( 00 xpp00V24S L1tP0G <UP0F $UT 0 S00 Us꠰pJ`̱P0\Dtij(Hp8Xе$4Զ 8Hhıȱķ\ܴ8x(dPd9O-0M( RC |9||1 0 0 S 0 0\ U R 0DS 0 0 U\U 0$S 0 0Z zUa?S R   pU >Q   0eU.lN`Tx 0 S 0 0 WU@T.x PU>S `R   FU >Q   0(;U.r 0S 0 0 1U .r 0S 0 0 'U$>S R   U% 0P' S 0 0 U& 0P' S 0 0x U 0dS 0 0 T 0@S 0 0 T>0 S .0A ?@T&0 TT  T R   T>S`D&> R d0cR   p& T-=)R x Q   DT/R 00S 0 0 T/R 0 S 0 0 Teu@@ T ?34 *TP OS 0S 0 0@ T T?S+?S ? SllR   rT 0NS 0 0 @ iT 0 S 0 0$ aT 0 S 0 0 YTOUP 0 S 0 0 KT/r 0S 0 0 AT=S R   7T 0/S 0 0t /T 0/S 0 0X 'T 0/S 0 0< T 00$S 0 0$ T$ T?S S R   T ?R   # S =R  0 #S ?R   d# S ?R   \<# S RD  P83 0#, S }-|MpWh TR 0 S 0 0Z aS R 0S 0 0 S 0 S 0 0 S 0 S 0 0 S 0 S 0 0h S 0XPT" S 0 0D S 0 S 0 0( S P0Q   0{S }@T T0!hS 0!S 0 0 fS U R00(0X }SЍQR 0S 0 0 GS< CS)S[P/ X&`pJ0<P\lԸP Ī @Tl$@XlzԺ$Dd]Ļػ|,,(@d,dؼ<7`*6ع"O-`M P@RᆳP5 ,A ppQ  : =HR@R,(RLp`: R0S `VMOMЍ \1 0RЍ0dRP40$0 4 0TQh140$0 >$ JQd(ORP!00d$ S0! 0  Qh()  , ,Q(  P0$0hR4 dQ0h0 r$ (0Q0 R  H0L,hD(0 (0/ `pJ,@PH`G-PQp@ Q200 R) \2 0 Rh00S ᵲj=PS@ h =@T00 SᛲU`b Q:=S \1 0Q>UY QP` T\P1 0LQU  QP % \1 0Q0#L{kP m`P@M@]TP 0S 00CS8/0#<1!8/Z=S@ E=@T G</ pJ`Խ9 0; 05XG-pRP @"Q딁00 R, \|1 0pVQT00Sp =`S @ ᝷@@}=Tp00SαW` P:=S \0 0QqSP z=S@c@@C=T/ `pJHȮO-@P 0<P8PB$P5  @QP 0 S00PtT   0Q P=  B\-C(С=@uP Q/?jP 0l/S00bP 0/S00ZP} L 0 S0000KP 0S00P# ?PA <R  8>X 2PLJ 0@S00 (PT>S`/R P20P-]Y+ U$ 倢 0*Sq 0 0 PW  0P R O |R  OP U U0P"PPO qБR<  POPU PP OwN 0S 00P OUZD ,q,QR  O넱 ㌡們0p4PpP:5PUR 0P H O-4<ЍON O ;N 040 S 0  O P 0S00 {OT 0P  rO`pJ<P$|/ X4@4l<7`*6 @4y(]A-pRP`00S@ ޯ@B00S @NX000 R D\@0 04"OἯ!/ `pJHp@-P`JP CM Npp@-P`JP 3MMpA-`@ZpP @"MM 0S S  NpJ`A-pP`X@P CY@P  D\@0 04N \0 0N`pJlO-項堵堕 M0 %PSNEu  |% 0 p%peFN0 X% ?N00450 04%,5N0%4.N00400$T$N0$\N004$00|NMMMGMQM[MTM|MehLzkN!hNL_N&bN&&_N&\N+&YN&VN&SN&PN5&MN&JN:&GN&DN?&ANA&=N&:N&7N&4NF&0NI&-NK&)NN&&N&"NS&NU&N&NZ&N]&N_& Nb& N&Ng&Ni&M&Mn&Mq&Ms&Mv&M&M{&M}&M&M,&M&M&M&M L# (M(M (M%(M (M(M &M|K'M'M*'M'M'M 'M'MMMM/MMM1~MzMwMK  $oM$kM \K ЍOwL*P `P `|  0! ! t, p20?2c/\ 2S \0325/ @-0@* BN@LQ/ // /0 S@0#/O-QMp`gK@0: MnLXu0 S*@PU, @U' 0S0 R J0P" R 0N0P "0 0x"LL00 0ЍH"(K@P 0Sr2 R' MPL0  )L0 0@$@0Ѝ0!0 0 1|!iL0p00\1PL<1 R= MP 0!00 @0!LL0: gMK R( MP  0 00 /L0: JMK\0XKxdoJ@D0,K0,0K `! h8DC-PM`@p뜂X`~KP5@ 0 0A0 B!1 !0@ (0"(I!(J(ሑ@Pl !0 0R2 5MP#Q 0 rK#p$`0@@ЍT1@T? M P0 010,!,1K 0 !00 0K0>K0 R" LP0: L!K 0 0p0X }KD0 D<K 0004,0K `! 8TB30A-SP`@< L kL gLLLVK L R  1g0SL0SLLL0SLL QALLL` 0V pPSwL LpL L AJdL 0  KS86G-M0  à@Œ!  `` 4pJXP 0Z0`   rJ P E0B10`b0 +IW 0 ` P0RЍI0p@-S@P L K0Sp@LL0S K K p@K0p@-S@P K K K0Sp@KK0S K K p@zKO-@lMp`PJA00x=H+0x= Z ZC00Sa aZB:,.u뛡"R70:}WO 0P`P000 000UY-=R]\cA]R͔-`0B=Եd0u 0 ` 0`0 +H lЍ9 R> \KP )0  09)Iꂑ0 R J|-hh  P0|-@$` Z T H   p RW0@0 00Q0C?o20SD \ [*0P00S p8(0 R JPX0,0 <0\00<<00=00>0-T0R  ? -@ P-A `` c 400 bBH$ `  40R   R  """,  R   R00##(#<  0, 0S 00S0 0##(#<  00 0S 00S00##(#< 0+ M   0 DL0D  H W 00$,P` 1S  *JH  0X(0 0  W,0PpTpXp\p`pdp-P /P -Q 0 pR00 ` |)G( 0 0CR0 4JP  D00$%45HW@$0G0P`W    P  SH#0S  $K h0qF lЍW``PP4`V(0 r R IP<0X 00<<00=0=T`S00>0=?0P=@0000 0,0@G00, 0 32" 0 0S 00S00##(#< 00S 00S00##(#<  0`0V 0 `0  G00`C F! `f  +GH`D0DL0tWI 0 0WK R {IPoPT0` `0WX0 W0  0X`\  0 000` \`0!0 0!1GR0j 001G1p|GC\0 0  0\RD /IP6P0 000`000 0SG 0 0 0G00`? G0h:G 0T5G|x00`p08 GT0T'G`! 8 Xh:<00@- MR@P HP P 0 0D D0YG F Ѝ00 F`! 8E  /*@-YA-P`*h pMF@P 0/p` P000S(P RG00|. CG- qMP`⧯0 V@  VE 0@ BV  ` V0S 0 R UHP00ЍX 0 0H0H F00Ѝ(0((|F00Ѝ `! 8PQ00Co//3P MP ZP gPM/P &P P / /@/@P&/g/Z/3//@-@尉@PFFFFFFFFFP JP'POP///P/ P*/ P*/ P3#/ 2#h 2A\0AO  p@-RMP`* R BoЍp\: 3:\6  RT 1@T6 GP" ``TGx1 @0r0` @ X!*F!\ L\ R 1@T4 ~GPЍp4CoЍp 0/``"G00`0 rE@``G p00` @[0\ 0h0Co``G00` 0 [~EON`! C-@$MP0@`S,KIJ$JJJJ,K$Jh0 E 1 00Sp $Ѝ1f#p!#3 p0ESX1X> FP `PF@i!0 0 Pp@0 E$Ѝh0 E0 \ 00Sp|0f#h #3 p0ES`PxF@0 p @$0$ DON`! $&O-P $B`,$0  0`4#zBO`<#0  0p3#kB{, 0S 0!S 0CSzp"`@Jt3tA*``0 p,3,A`P\P 2AP`0802Ak2dĀÃ2 0$@4G D P`0 p2.0A`0<0pT2TAO0nq0 QP\A>>000@P8`P`0`4`@`<`L`H`0S 0S p3:S p`0@0`X1@{A(1 R4 5CP `X!0 0p @1 A`$!0< 0 1 A<`000LA0 q0` `A`0p0<:A`0  080 4/A`! '$`6TYjQ`g@9|p@-@P&p@@-@ /4@J030G-SM < P BRJ 0刈00m0Sp0P<   BP000W 0S  A?=.  pQ, 0B,CZ 0@7 @9DyWpDy 3 R uBP0 00j Ѝp # WD`30S YBP ` <3 0p,3,#@ E49 8 0 @49 10""SC S05 59ĕR 05)P " R $BP 5t"Q`l2l0 0 T2@"@#  !   # ͓  RG RD RA R 6R<m0Sp;0S08 0C50@C0@@L@?=.  p_P, 0B,"C0@By` 1 0p1 W@GZE  @ B#20S C @!SDQ&20 N@`00x0`?&`00 @0@@?<4S`0 0 ( 0?`! ]_8 96O-鬑@ MR`pT nAPD0S. ttP@0@SP$0S YAP 00000 000@d0 ?0 00000@ 0 d y?0S$ 4AP 0 0e0 ?Ѝt 0  0@^0P ?00@80^(Q? e0ЍOI?`! |`\A-M\Pp` 0S0R R+ 0 S:P1@T? @0P$V0 Q 0S0 R 0SP:0@T. @P00Ѝ000Ѝ0@@0 U?0x0@H@0` J?0D0 8>00$0` >0`! |Rp@-PM`2S X" R @P3Ѝp(2 Rz z@P 2)"0 ?0 @R0@ S0DS1 Rb [@P 19!0>0p!2 0P!>ЍpUT UT UT 00@0Q0  RT 0T?000#200 1<0"300T#1000 200"2 000 00LP0B>~4P(0;>w00 4>p`! |$ $42@o/0p@-S8`8` [@  $ >& >J024pL<G- Mp=Ⴇ`Q@+0  t?80#< AQڶ3ᦁ ` 0P@3< 0B Q `pP@`p00 > Ѝ D0CD B;>7@-R0 0RM@`a ?P-P PUb u?P4Ѝjz='R;: PRWZ c?P ` l1 0PV0\!=H07Ѝ:*'=`0C 0 L0 =`@ 00 P0 =ЍZD-7 07Ѝ@ >:=`0C XX0LT=`@@ <0P(J=`00V 0 C=`! |XO- c$Mp@WP C >P,%U 0 0P z⁗Y? RV >P `"0 0p"v0k=$ЍZ7S07$Ѝ`p8"0 0pPe0! M=`&00 P 1e<8 8' dၷY<0P R< >P  07`00v010<` (1 00 !=W儇0밷 0R& 0f>0PD- 0G7A=`00t0h<`D͚d 0  08 <D`00$0 x<`! 0|h8h0@- QM @R0 (>P;P R* >P Ѝ0@Ѝ0` 0 0 0<`h 0 0P 0<`00(0(2<`000 +<`! |0@-QM @R3 =P: ';P R* =P Ѝ0@.` 0 0 0U<`h 0 0P 0I<`00(0(;`000 ;`! |L0@- MR@ =P `h 0 0X 0< );: 'Ѝ@-`00 0 ;`! |A-j7MS $qP @R+ a=P ;U၇Ѝ;P R' K=P ЍA8` 0 0| 0;`00T0Tp;` H0 000 ;`000 ^;`! | 07/p@-J\Qp0S a:0\9p00P៝P0\9p\9@6 Zo <';\ G: P@-Mm P@o P` PWsssHshsss4t4tss00ЍR R0=C<1!v;R0 1!n;R0=C<1!d;R0=C<=t!tZ;R?0 x1T!`TR;h1@TB <0P }@1@h@b?!+;0 1pW! <P0 -;> (;0 #;|0h@0h  ;| @` 04:|H0` b :0xz6emi`! (06a5Xp@-a@TP0LVM 0,:P`P 9`PЍpPep@-P@ P  MXUh l P5T5pr0 0R0@-04M@PT R. R  1:4Ѝ0:$8-4= $ (0,0\1 R/ ;P;` 0  9 8 ;( 9:,-0<=,0:@9 $ ( ,0( 0,00 ( R$P`0 0 l0h9:(- P,0`< 00  00 2:`! 0P : L'_@- 0  3:68d5p@-\Ő@M R#22c0BS ^0`@T e;P ` l0 0PG?X 9."d5VЍp`00 0 G9ꉈ`! 0S/!A-`MVP@X 5;P@UP; :UZ-:\9S1 M @80 <: ЍA:Z:H `e8P c8X HiPi_88 Xi\88iY8g>A<I\9S 8\ J80\9Ѝ``K8ptG8p 00d d0{9<`p88(48 0 9`!  %0 RQ   /0@- @R R  01S   Q   \0A-SM@`3 1 \9\x:0\0U^7690PX5( 870SЍNPz0 Sg崇 PЍA-7L0S A^ 0S0S 0@T G:P z000| 8P 07ЍACP z 0`80`! X*"4S00@- MRP@ :PЍ0g̓0"4/`0L(HH0<8`8 0 0 P0 8Ѝ0`! C-0Z"t0WM@P 0G0g=0`f0$ sS0"4icJ>N Q (PB RB PA0P(@0 R* 9P ` 0 0p 0 ?8>>Ⲁ#DЍP P P0P@ \0T XX98`00 p,0,,7@`! 60!S AS S ///@-{PO-\PIMU@ L5 R U9PqPIߍ5`  5 %7qPIߍ : `$5Pp\ .Q7딤pP( Rz %9Pi~ᶀ\Lਏ00X4T@D0 R ! ! 8  ("( PP 0St X 8P g`pj530pP3# 7q 8P 0S 8Pw q  x7P pW 8P.0(#A80\``@ß0  00<8f` 2 0 pP2"I7`026`00tl2p6qPK8 ~ 5p2d2<" +7 Rv 8P `("0 0!270` 1 /c}\e80\0U^5#70PX5LP8~410pP1X! 6xg`P4P 414 6'h8~4p41 0~6a\8 4 0r6e0 R ,8P ` 0 0p0x 60`  0/}jP`00`X0,M6`00XP0F6`! GSac7<jh2DRpA-\Mp@`Pp4 5P a8!#40,0 #3`<3,0)# !J,  Ġ,  Ġ R  R $01$0`VM_0]-Z z`V  S3PZP Uo pWagb 0 0^K 0S $ 8  0$0Sqg!r$sY㇏ p $0SP 0H 9RD 0  R  3PH0S0 S   3P 00I0 0J 0 |$ 0t$0 1p 1$`DJ00<$ 0p `0$ |1P U0 00CS#013,ЍO 0$p&0p 30n0X ",-./L 0 4 8<2##(0#<  0 0S 0S 0S 0 4 8<0 #0 R##<  0  2P 20p2|" 1S  t2PB *0 X" 04"0 16`VX  `2P { "0  0^?! 0ns R0$ c0000$ 1tx0'!0 0X!|1 0Pl!0 00!G? 0cB00 0 ! 0 0 00N000GI0H' 00 0^<000I00J00 X0T00:0 T04(0808 #0" ,Ѝ`! / . 8$T( D@- M`pT1PU 0 R  1Pt0 Ѝ 0 0 0 M00/ 0@.5.x1\0 R  1PH00P@0(  )0$0$ /`! <z|PP0@- MQMt$1  A0<P P 0P P P P+ Ѝ00!@  P4 0|.  0$"$! l$"$!L0  D@, R ,0,@1 E/. / R\A-P`@pP @P@ W/A/ C-`MPP@p8+  0P0P( @0UPPP' $Ġ@ $$L p  @    ЍCL 00@ @0 o/ 0  / Ѝ`! O-`4M0@ 0X00\0(0T6P`p$0帶M  0P2 0:0PV @@  $ %P%(Ġ%\嬀P +*)$W岰崠嶐 p4ЍO>( 0.0 01(@s/ 0 0@ |0|  . T010(,0\/,0000 $0$ . 4Ѝ`! C-`l/ [-,@Ѝ.0 S ,@00@ ?F,-@`.`Tpc TK @TtP/> R  .P@+ЍpT T_Pi`> R  |.P DD.0  0p,>. -@PU= R  a.P 00=-p  - ,PH= R  G.P x=-0p@ l=P8= Rq  2.P 04-0p  =< R  .P 0,0<, ,P <]P h@v<SP3 P|@T  -Pj0AS[긯l@p+@Pm 80#<AQ'ڶ3 03<  , 04 880Su  ,PT 0\(0 ?70S  ,PC 0(0 87 Re  ,P2 0'0 7R^  ,P#  70 @?70S=  ,P 0X'0 T7 P 7 0  0 6*D 7 @1Dᰐ+&0 0 @6<& +{0 RM @TD :)K@d6 嬐1ᰠZ+ 464 *V%!L$@@1PQ`V6  >,P l5050% @*0000TL5@d* C(] P pW  ,P  4R D@l,%00 5@4l@*q R  +Pi 40 ?0#<0S `V  +PU _l0$0 4 4Rd`Ol `4@ *?3053x*@430X3L)@)D0CD BZ*303)@T30=2)@ R  +P L#0 0"<3 !*@20t\2P)@ @(@00 2)@00 p2x)@00XL2)@00,2)@k <2<@)0 $( ,0A4o&@@p|1|g)@00(1`)@ (1R$A@k@ X1X@P)0J)@{k 1 @h?)q000L8)@i00 0(/)@`0))@Z`!  @ 8  / ,l L     < 87 O-p$MPPT0dL@P0X+  *P"50P) @0%$$(&ĠP @P$L`P  @$ЍOHT 0d0@?@  ) @`0( $Ѝ`! 4 |0##1@0SQ /@-@R0P @0$Ġ$$,@ @ ON0A-pPSP% @0 %%!Lj %,P$@o P  sKOTP $0S,0SkP=30c0A p@-0MS@ D! R>  *P*Ѝp10<`V P``P9 @P  ;(Ѝp@0@T#  )P 00 `? }(| 0 0d h0 p(Ѝp0@@0@ (( 0 ( `! / d m 0 0Rp@-@MP(`$  )P>0P$ @0$Ġ$$,P@ Ѝp@\p0p 10 0 @T0T  ((40100( 0$' Ѝp`! /  A-Pp`P @@%%(%< P0 'pA @-RM`p!'@P? (P@ (b&&J&L' &'s&%P20 <@\s(X1@T  #)PЍ@ (1 0 `@=! 'Ѝ0 '0 ' 0H0 ='0PU  (P )d% 0D0l 0 'i)S%` H0H$'/  (l`! 8  6  @-8@0<0S  '0<?0 < / l00<P/// @-M` ,&@PN 1@ <00R@<0=  (P,8p#<0L@S9ڶ3PL @ <0J(%`00P 0 %`!     O-ZQwMW@ @3` Rd  'PЍ0@S&3PUx  'P `@h"00"j0 &Q`"0 0 `b0" &Ѝdb00Zr  d'P\0pdpP70$P Rh  N'P `!0 0!x0 %ЍO0`0b1t% `|w R  ('PC@- @1xGt7ЍO&`@g@ 1jN%r@`000D%`zg 0 0po0  %`jg p |0o\'%`00xL0@ %@ ` <0  00 p%`!  H < 0@- MR@  &P `` 0 0P 0 P% Z$J0P7Ѝ`00 0 $`! \ @-@ F$J0P7p@-@MT 0P R* `&PЍpT0 R! }&P 0 0@  200h 0,0 P T %@040,$00@02$`! 000%1S :44S  AR 0/ R00C?o2/Pi4S0i7/0i4/@-\R #@\cD 0 8@`$@h%\ 4Ğ\ @AT d40R: #c$0\ \ d40000%1S :44S0A0C?o2/000%1S :44S  AR 0/P03000#/x000%1S/:44S/ AR/- M  0$ ЍG-`P %1(MS@Lp :44S  ARA U $ 0 0 0l%P? T0R +,B, $  0H80 P 00000%Y 0S6ST S (# R o%P^e (Ѝ! RV R R8I2 Rx S%P `"0 0` P0x"#W:40S:40S0O  RI  CSRV00 2$Iz40S& S 0 40SV 1Q0 1#` p!0  0P!X1#^00 4$1WP0z S00 0#p`0h0#i00 0#a:4G?0 |0#P0P P8H#}T00 40#E` 0"^=`!     %!R/*4$R/ AR/@-?PP@0@-ASM@`P) S] !S#h2|3" E4Q SЍzc$R+ 000%1SU 8"cdTЍ000%1S z4P  d4R R h$0E2cR1 "Sc4S72PUm 3$P d`P!\2@(@P2P" "Ѝ0S' "‚h"Q 2 2 EQ P4P 0AS c$Q Q0& SS@40@4h!h2`1" E4Q} Sw0S S S@40@40S9 0c$h4tS10 0"@4c$0@4g`@!!@0 !N@$ @$ hR RCs AZSk*: Rs0d44 dT1}?0 0"ON`! \@|p@-@MTH <0P0CS,` 0C$"ddh&hV> ! Ra s#P 0!448P#8& < | B B0? `!!ЍpC B!!*A R!0:25A0A005 @0@0#0 :0:@- SMP`A#** @1@D*@D @D@D @D0@D@DV 0pW  PЍ@.ᨅ\ 0 0@ `0D ᙅ@` 0 `! XO-TsM`Z@@Pw ` PPX0 0000CV 0S H P!qЍ U`_0V" V<0Sx / P J H2 0PE?4"0P0PCЍ`F`Ѝ*!X10 0 ` 0!R0B`F0`Ѝ T!XL10 0` 81 |P`PЍ0 0 J00 `< W!Ѝք00 l0EdɄ 00 00 0C0` ,0!P`! dXP  4*0*0C 0C R0C:/!ʂ0C C@@/0p@-SM@1 S*1PUc 0,cP 0,P5`!0D0|!0 0` : 0 @!lЍp0$!(( 1PU& 0,3P 0,P`e 0D0 0 0 : 0  <Ѝp`G` \0@B`:` 0 5`! ,Pc60-R M:  0 Ѝp@-Pj M-\PTpD@T ]Tp7PTpQ/C-:=-̌\MP 0QP\ 1`p@W1 0,PU Ѝ0,p}ὃ 0 0 P0 ,U0| : 0 \ ЍXᘃ P 0 `! \0C-*M-\PT M ``pj@T 0S\  0@T ЍQ/O-PMJ=-\PUp 0U Q0 qpU<1`Y8 0,#PWMU @U0 ~: 0  4Ѝ0,= 0 0 pv0d  W % p 0v`! p@-`QM Ѝp@@,!h1P  :=-^  0\ SR*1@T3 0,P 0K : 0  Ѝp0,@u` 0D0 J0 *0`D : 0 D W`` 0J`! @-@a,1M PJ 0 VQ 0 : 0 ` |Ѝ0@T 0,IP 0,@p{p00p 0 Dphp 0c`!  0/C-Z@Mp`W 1pWV 0, P 0,p<X!00L!L1 V00Ѝ!`Y0" 0,P 0,P00`p0  k 000ЍPP ` X0XD 0 `! h 0 H!0 :RC-PM`@2 T% 0,P 0,`p᠁ 00` p0 00 0cЍiP =pp7Tp u ` 0 `! @-Zĕ$M| 9:! 0C"*0C2c3# #2P031BT 0p `R  P$Ѝ`ĕ 0 0p @0\ $Ѝ`00 @ 0:cbp)ON`! C-z0$MQP` ,2@TF PP$Ѝ y1@TZ P =4!@0  `@1!Z=Y!0RX1@TD P b@!410 `@ 1U 10 `1 F0!00@ `@ $Ѝ2=l 40 @\0 XT" 10 `,0 (|`! P_ g S 0A-0M@ pPڟP :7S ЍZP>Sj̇X(2 RW 4P ` 2 01!W q RV P,WPEUW RS PЍAS\!P SPRG P#W` 01 0P$1!7`C 0 0 {`000`'0 0Pp0 f`0H0h0hT`00H@08`00P ,0,`! 6XB =OLC-\ M@'\pWZ 00`MZ7 0j0# B7S07 Ѝ 607 Ѝ,Z70 0?07 Ѝ@-0  8 96@-G0 6 O-:Ⰿ,MX/ 0@DT`C 3T( T^#pp` ! $\Pu 0#4Y \? 80000 \G 0/RtP00 0 @R0Uرc 00 01000h1000c 0 0000000 $ 00 $PP030# 0ON.  0p@-4@P  H1  04p@$1P ! $[P  04#20B&S S   0SS  QQ   Q @R S S 80   @R    `P$[V 3 # / ONL8@-4MpP`, @KĠ `P@ 4Ѝ0P /P?5P@-0 000M700M0@  000@c0Ѝ\ 0@-R MJ 0J0P0Z / N7S07 Ѝ0 B07 Ѝ0@-0M0 @?PЍC-P4M @`P :7S 4ЍVR V V2 T2T"TT1S .  S`, 0c(p/0. 2@T\ 9P?2ͅS 0C4?0 0T4Ѝ1S $ S0c(p!`/0"`00@SL.0@0.0"0(p"#0"/0`0 .00.0`@"/0 0 0 0@0  {`2/02 0 P0P(  (&PPc6`! 0@-^Mp0 B 0000%1S0000S( S R 80@ P@BTP0B@0PB3@ Ѝ00S3 S81h@S20ABSS00 0 Ѝ00h@S20A40C?o2S000$ R :R 0S 0 00 0S`0  p@h0TB@A4TQ00H0H HH#<AD@D B0C ON06lj0@-(1 N0SM 0R0 0h@00%1S0000S20A4S000R 0 jЍ000 00 80@ P@BT 0B@0PB3@ RЍ0#<AD@D B0C ONljC-H0`p0# l3`V P@ 8Pp30P@3t# nwL3`V~ P2 8`V@30`43 # T"*@9EyE,W 2 R P `"0 0"27$0SFl20St PN8Pp T100P4S0#E9%*X 0 70WE910SL _P ` 1 0p1t!8 P1T(8`P$ L1P @1 8@@0 e 8`PP0$ xT`00 0XLp`00ph0<Ei8 0$<`! ON8 96k\ P@-MdP <80#@@L+\<@@ ڶ3,0<@3Ѝ<0< <<o,D0CD Bd*8x67O-PpWM$ @P \`V P0S 0 S N7S7 UGPP? @80X%A B+PX%  3 ,`A,0\3@`` 0SJ , $0Z Pp P `Pc Wߍ\P U\ UH00H0PP0SS FP h`Pv0 0S0S S0S S0 0p0@N7S\P \H00H0PX50CX5pWp @W pPh+ 0< S 80^ AQ03+0Q3< @ 80< AUʶ#40S < 嶳  @0P 4P , $0PZ p` PM P2 ='0Sp0Y0%0Q09PG0S-`U>PP @0N'R\P a\H H `P X0 AX@8[@hP8P x xXP 80#<AwQ`ڴ8 3Rx0x < 3x hx j, $0PZ p P P `@80@P=$``'0D0'7 _$`@707@P 'R !RP: 6:P@0l4Q <  B R0! -0  0$4 $``7`0&P7Ph` V w6h20G40C?o2S04U R2 4S4S040S+uH6PU P9 $VP#@60P@06& !)$`E 5$`@:@ 5#<A,D0CD B  R8 ZP `0$00X%0 H5 % U 0 R* Q <00CS77PU>$h0G4QW00s$ ` 4XW`70S1S 0 @Y7pW10Sq ,0S]Q> <0CPl $$``` 3Ph`' l4Sm 4.Sj$0R4ePPa 80< $AQ303<- `h`PI0# h$|@I@ 2R<`0l4 Ph`af2h"H6Hh 08KvP :PD `@H@ 12!%xD0CD B 6AQPڶ30<3 6 P 07<`@(10@Ph1! P1!$$62<`@ @ 0r1 "D0CD L i xD0CD L DD @0C``! ON80Dlj|068 9Jd78%:L7S/@p@-`M@ PP0: P BP0PU: 0S  @P^RPЍp^ DQ @-@8/0 00:P>7/ L7S /0S0M'R/O-P/0 4SM@ P` /S$ ,S- /Sz x? RJ |P20 0DSH.<>Q@0D@>U 3+S@0, ö#0-<0Œg'0!|,0$p P0P0P 0i0 S+ 8 3  0P(0  (0z89S 0S  P8 -08900@Sz (D)2R00%1 0S H9S $L-L‚x͟"* AR H)*P9S $T@-L‚8͟"* AR P) @ PK@)L0@  H)R P)R  00T9 0P   S$v 8#<AQڶ# #< @0 L'0R[0(0 0P @ R  ' PUz kP@4  >:pP( ZS QP^h;#`+#:A 0:`@ `F!Vy3@0C8#8 Q3@ 6  \ S Q< P @ K0S S S 9*tl Q  %디@pW W l9P Z  Pad0S}0 z 4@xpZ  P00S S_(P 94 #20@&S SppapW  P s (0  04)8J 0 2  C3 ` `P+X X 0:`vpPz  @7 R  P  7@ 0@7L( `'~pP   0pP:    @6 R U P  47@ 0@$7' 0S45S80# ~  P p ,!0 0P1! k e80#<@Pڶ3 0< 3 + M \14$B@B&T T@@@ :"   5`! `!o)3 e8h  8  H8x;  k Igd(f ! 8! kL  60 `! cbp)@p'7 ON8`V ] P^@  10p1P ^@  818 f  0000 p1ps P1m @To ( @P @ X10\1@p 8!@ 1`V   P  `10`p1`0000 d22 p 00p 2# z @P0BL0=80#@0.00 0@D/P@X` >10A0t.0 @&/P@ 0}0SF)R RB  0 0P/0F9M @PL0N( P[Y80#<AQڶ3( 0 < 53 (0 5 '0  X) @nPL0@ 0x0X  0`  \ <0 0CD0  ?,& R 1P 0`50p5% 80#<AQZڶ3 0< 3  0 ` \ < 0A D5D>H07  >50?%E` y`4 m"=$0$ 00 4X<3S&n4@$0S :SQ@{V3@  d 3[ 00 3@(P%M,#0 0 ?d#!. , 0`p <p 3 O( 434^@03"( `#0 2"(0`002( `"0 2P"(0`0002x, 0,0 2d ;0S P 10P1! 0/0L9 0H d1D!X 141 !t p1 l 80@$ @"Q "ڶ3@03@ @'j`j` 1@ ]j`\` 0@HO#<AD0CD B^~g68 9 !    D 0`4{x>Pc6  'ljO-`$M50V5@H弄u0\P8  x P @``u(!0D0!0 @ 80 B+Q+ڶ3,B,03@ 0R @0@PP4@B AB岁BqB@B PB,0($$ЍO`0@0B00 P0Ht#<A,DD B0C `! x!ljG-8M`,pX`PS1@TC P% 4U@ 0  0 =#=0pP8Ѝ,0 P   0 0 > }80#<L\3 03<  \,0P  00 <04DP0CD B ``! !7G-TP M@DJ pYXG:N7S  N Ѝ0 )P ?:P8pG `P 0S;  W`80#<A QH3 0< 3 M+PE#@0@,0, B(#0 $@0, Ѝ 1! t Ѝ< 0p >,P:80#<L Pʶ3<D0CD B, 00 R P| < p0 ` p 0d  *JcS<9 v< `pT 00H H0 ` 0 `! " C-LM@P0S` ÆpP1PUS +P( `@X10@pL1L! $1pW* P, {0UPP,P0`$0 0LЍ0Up`p 00 p> x0Up`v X0@`@j@ 0`! (# # #\#*-0/0C#N^𝴽-< ASoS00 䣐s0c00 䜐0A-PP  @᠀p`@ pU0 @@ 0S S <o0P0$h00@ ###C-PpS㄃WM`h @a0S`3@Tv ]PF/00 +Ѝ 0X ?0 0R00Rgq! T:0S7 0000a0@@DOo0B20 0Wx2@] Tp "PGT0 0Ѝ 8a"0 0 t0"00001@T< P 810 pl0!8a00 d1t\0L!PP8D!0 0p 0!eT, P i8 0lX8up 08j 0 0p 0\ 68[p D0$ 7#$`! $@$#$|$6$$O-RM<@dd$@XSMpP` H3 R mP4Ѝ#d(P 0X + R 䲟  a @2`Vu JPMXZ$ffffffff$ffffffe$fXT"0 0 `08"Ѝ0S S00 P P:/0SB1PUO P 1 Tt!a00L!0  @z0?,!00!0 s1a00 0  0 @0 xN t0LX008`(097#$`! 0%#%#%%%D%%#|%O-M`7|Bp]4B@T$P$4PU  P ` $4@ H 0 @4# !Q'0C1 004 M0 *0000(0  0pp tPL(}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}(}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}Ȁ}}X}}}}}}}}$7p 0Zv7q7 77 rd700 7hZO`7 080 T780 H,7,'B'7 =l646  060 01C11000 '6 0S S S |6'K|&00x6D6 0P5,f@V 04@0S\(&Pl WP` 䅟0s (0  xPHiXP> P1P& z=-Q *!R 0SQ ?S P% R P0,:z z?S $ R Ppz/40:P  4 P0:IPTmHj<g0 d$ abP0S: @T0S K38 38 P UX`30\P#43 x@83 Ph `0JT3 # i0: 00(gPGPf0S<0S@Ӿ\0Sڷ0": / "0 0"2c0":? 00 0h"p2: 0?0@424NI $(2(H*P 0 tf0 0 0 0$ t0$ \ H0 0@(P. 00 q0, jx+/ P H*++x! h! /! p!  .. P P00  0000P0 @TPp WЍP004 0 $00 0L `! ,4. 843@-P0(@ M0  Ѝ. ,40A@-MS.Ďd<d:!0  Ѝ07   Ѝ0@   Ѝ0=   Ѝx0@ R PD0H LL`H 00C0 E0C4`! 064@-MQ/(xPȐȐHH!0  fЍ0   \Ѝ0   RЍ0   HЍx0@ R aP0H LLH 000 04`! 064@-MQ/,ܑ,,0 !  Ѝ0   Ѝ0   Ѝ0   Ѝx0@ R P 0H LLD0,:0 000 4`! 064@-MQ%hhh@  0  Ѝ0#   Ѝ0&   Ѝx0@ R P *0H LL_D0),0 00)0 >4`! 065Q@-M& Q@ Q 0 R1 P"W0 30S   [Ѝ0M   QЍ0P\   GЍH 00V0 0V`! 4064Q@-M 0`   $Ѝt0@ R =P P 00c0, d0 ((0cf4`! 406Q@-M 0m   Ѝt0@ R  P P 00p0, q0 ((0p54`! 406Q@-M 0z   Ѝt0@ R P P 00}0, k~0 ((x0}4`! 406Q@-M 0   Ѝt0@ R P P 000, :0 ((G04`! 406@-@QM T 0   ^Ѝp0 R xP P 000, 0 ((@04`! 4060AS@-M 0   -Ѝt0@ R FP P 000, 0 ((0o4`! 406@-@QM T 0   Ѝp0 R P P 000, 0 ((@0=4`! 4060AS@-M 0   Ѝt0@ R P P 000, r0 ((0 4`! 406Q@-M 0   Ѝt0@ R P P 00<0, A40 00N04`! 406Q@-M 0   eЍx0@ R ~P T 00@00 80$ 440 4`! 406Q@-M 0F   1Ѝt0@ R JP P 00<0, G? ,,0s4`! 406Q@-M 0   Ѝx0@ R P T 00J?0 40$ 000JA%4`! 4)06@-MQ괞ԞܞԞԞ 0  Ѝ0   Ѝ0@ R P\0L XXxT 00O? ](0O649`! =0640< 00S  P /0/7p@-`P@L30 00S  P b0T"@Ppp7 077/@-Z7S0C$M7$Ѝ0R@0@0DD74B2S@T@@HDH?T?@O7`@l!Sp ( R<  CP <T`4! 0,,10 0`@u0! G$Ѝs@DHDH0T@R%  P ` 0  0`l0  `dSX`1X 1`<0u<7G`(J$0l/`! &&4$/0 60$0%0 06 0$ %  6C-10 MP `0H0`(@T 03p 0 @T Ѝ\Qp@-@M` Q P0X   Ѝp00 00H 0J6Ѝp@\Pc6A@-0MQ'Ԥ|` % Ѝ@w7 @% o70vd   KЍ Ѝ@$Ѝ@x;}0 \06Qp@-`MP@s;0K<   "Ѝp@mO0 \06/0 50 1!1 05:G-- MTM PpP2`340  \0 @TЍتAp@-`M@Q2Ԧx0!1Ѝp@60P!160   Ѝp 1S  Ѝp@*0 ?o2 1Ѝp@:0 vت06p@-@P0P00QP TQ :`?S ]R 0 !!! p@Y5QA-pM*::M-l`V@V 00S :1PPP@V0d<   VЍAKh0 ت06Qp@-@M` Q P80X   5Ѝp00 00 05Ѝp@تPc6QO-` MP# Q!LZ @\3psK 0 O T0    Ѝp0h ll 04!L@pZ @\3sK0 OT Ѝ(Pc6C-P M0 4!LD`Z @\ې psK0 OT Ѝ(C-P`@ M$`%`0 4T Ѝ!L@pZ @\qsK0 OT Ѝ(C-PA$M@`4p Q񟗦ج Ы<<ЬЬЬ0%050S <U :0P```p@or{40S 0,P 0,\%3\#V`#`ßW0 0`0# $Ѝ0 ~?o2$0$ЍCq90SM 3`V 0,MP 0,`p"00"0  4$ЍC0%0$ЍC'53!LbZ @\3psK0 OT$Ѝ%0S520S_ `p}0" 00U%,4`P1pW_ 0,P 0,p(!0 0`0x! {T!0  k0@!@0{`0 XW % Q000 `0 I倀`~pp h0X`p` 80`! P<LD(X06<7`*@-@P ,b00 0$ %  @ 3C-P M Q@ ܱܱܱܱܱܱ|||||@z8`M 0 ` )!LZ @\3psK0 O3T Ѝ2!LX`Z @\3psK0 OT Ѝ`0 (06 Q- M  1  00P Ѝ0 (060 20=0 020=0 02Ap@-PM`@QRX(((((((((0H RC $!0  Ѝp 0 ?o2<0Ѝp@7<0S 0 Ѝp@0=030|   {Ѝp0=0Ѝp@3Ѝp@10( ((9 * 0SD06A@-PM`@Qu$\8ddTddddd̴̴0H R * 0S!0  1Ѝ 0 j?o2<0Ѝ@]7L1`VB 0,<P 0,`pn!00 u0 <0S 0 Ѝ@k0=030   Ѝ0=0Ѝ@3Ѝ@Z10< DDp4p 0u/D`! X06@-@-P -0P ,000 0< =  @1Q0@-P M Q Ѝ0@1V0 o@60H R 0Sh    Ѝ0 * 0Q,    Ѝ0 0SD06Q Q- M 0D   i Ѝ0  2 031DPc6Q- M Q Q 0 x 0  C Ѝ00HQ @0 4 Ѝ 0SD06/0 00%0 000$0%0 00 0$ %  0p@-@A=DM` 0CQ1xL 0%0Ѝp@20P%0 20   Ѝp$ R  Ѝp@L ?o2$0Ѝp@ 60 P06p@-@PA DM` @Q/ꄻ\ 0%0Ѝp@10%010u   Ѝp$0S  Ѝp@ 0 ?o2$0Ѝp@5|0 VP06Q Q- M 0@   u Ѝ0 > 0@0PPc6Q0@-@ MPJD5t;LQ 0MT   P Ѝ00 K0 G Ѝ0P0 P06/0 00%0 000$0%0 0/ 0$ %  /@- M@pMXP306`  )T0` #0`  Ѝ蠭@-P@ M`pMDQ/꘾p40%0 Ѝ@ 10%010    Ѝ$0S  Ѝ@D0 ?o2$0 Ѝ@50 렭06@-P@ M`pPMDQ/꨿D(0%0 Ѝ@00%000    Ѝ$0S   Ѝ@0 ?o2$0 Ѝ@40 M렭06Qp@-@M` Q PN0X   fЍp00 00/ 01/Ѝp@4꠭Pc6Qp@-@MP`4%LQ 0\T   8Ѝp0 Z0 /Ѝp_0 렭06/0 .0%0 0.0$0%0 0. 0$ %  .@-P@ M`(pLDQ/X0%0 Ѝ@00%000    Ѝ$0S  Ѝ@J 0  ?o2$0 Ѝ@40 06@-P@ M`(pVLDQ/h,0%0 Ѝ@/0%0/0t    Ѝ$0S   Ѝ@ 0 ?o2$0 Ѝ@3{0 S06Q Q- M 0@   r Ѝ0 ; 0=.Pc6Q0@-P M@3(0 Q 0LT   N Ѝ00 J0 E Ѝ0O0 06C-P M0  .MD`Z@_⸐psK0 O;T Ѝ@C-P`@ M8`9`0 -T ЍM@pZ@_csK0 OT Ѝ@AC-P$M`@ Q񟗖LLxxhxx0 ! ?o280300ST :1P`p@orV00SF20Sx 0,P' 0,\"\2V``WFDR8902Q44" \,Ÿ0 0 P` 0"T$Ѝ80S-  $ЍC 090.00S80S 90S%l10SO 0,P 0,h4a Q090$ЍC|.$ЍC,0!% 0  LDpV0 XP89p0^tt  \0! 0pX0 P,P0 p P`! P<DLXd@06@-@,P ,0,0 08 9  @,ꨮQ Q- M 0D   Ѝ0   0,@Pc6 Q- M  1  00P Ѝ0 @06@-@M QLLLLLL<444441BD 0  ЍЍ@ ,S0 p@06O-z M4@PMP `Y  SPY),!R`PE  [Z80S 010!PU) P=-`= 00m=-Ѝ0  0L\ 0 0P E0> 0E `! TG-M 4`VM- p@T' P PT 00S+ 5P 0 =-00 B=-ЍЍX00X0L $0 XA`!  dTH1C- MR@; P!]4P=U  qa@ p 0@U =00= Ѝ]=4PU  0 Ut00h i0U]=4PU 0 U 0 i`!  ܯT= 4 RS -(͑=0/ G-P@(pk`P2 g@*@}$TYW qTP Pk@@cWM\GGWGB0 0 T6@-J= 4PSMP   -P=0` 0 p 0 +=.0CRp ` >-0S>0>U  R  1pЍ A-@PM` +p(T $ @0 NЍp@-@P`PpVU0Pp00E. 0@-@MP 00/0S  P 00"Ѝ0SPP0 Rx R  P 0 P B? Pl08  0C0l `! C-pQ M`/:M-\PT ꜐(1T @T P P @TQDD 0   Ѝ^0  6@-0  0S S S |?z0@- MR@  P p 0 0` `0 T0T @0* Ѝ 00 0 /`! ȳ. RC-PM7X20` R^  Pq4B1p(!02P~ P  2p(!p00: 10Ѝ`BV@BlY.Ӓ$ 0@@R  P=<1HpP  0  HЍ`00@T#  vP 00 `p0  0 0d p0 P 0D0< @0 $`00 ,`! . $@-@MT 8 80 0 0Ѝ0 +.06P /p@-P0M0S! @ PЍpo 0S ``@P 0T0Pt0t  ЍpHW 0S ``@PPP0  (`! < p@-0MΑ.<0\ ^  >QS00Ѝp0S 0 n0@PU 0,P 0,P`p 0D0P 0 >x`` $0꘳6`! p@-PM`@fpP& 2PU 0,}P 0,PO`"0D0"0 l"0  =Ѝw42P' RV  SPEr00,0: > Q0 1 8 PPP PPUR 0,*P 0,P`\X10`p08! 0!  Ѝ 1  0p0  00006`-` 0|(PP \0 00 z`` $0 `!  HQ0S/:>.Q 0 QR@-0 W00/60Q@-M S0@0T   mЍ0, ,,6   _Ѝ蘳060@- M @PU P Ѝ0@h0 R  jP Ѝ0400P,0,  0`! e@-0S Q 00@ 0  rص6 @-(M0t( 0"P 1S0c#  c (Ѝ0@T P 8@h00@v?\ D0< @@$w0 v<`!  6,0@-@R/0 @2. / :..<0Rp@-M 1@0`0 ZP'  P' 0P  PЍp0 R  P | 0 0 l0\ FX0D TTQP00 L@L $0$hL &`! (t6! @0 0)A- pPtF PMD`L@P@0<0@0#80<@<P7ڶ30<300~80#<L\-3<00 0W4#$0  @0 0ЍA z@0@ @@D0CD BP@*8x67p@-!0MS@`GPU8 <00CS1 IR'  P00P@ PEU'@ 30CP 3@P Ѝp@質0 0$!0 0!f0 0000f00  0| 00$ЍpR  P t 0 0L ^0 O H0$,0^ `! t8 96kP:? 8Sp@-@M Q R 0S<1 R= P !00!0ЍpP@PEUP0`V) iP P0  F0 0Ѝp@? x00P0T @400 ,0 x`!   з0p@-@*1M S00P@#0@0kPpЍp7 0`V P X 0  0H w000 0w 1`! <O-@M0 | (0$ l0P 0 0#@(00h000P 80#<L P $0#-< 0<#0 0P0g $0:00 S 0嬢!lJ$`p~ P&pskWo0 00Sh @(L2 Rf P 0 ( 0 " 0"2 B P OPP0M[@0S P 0S^hP1 #, yP l1W%P] Ѝ$1 R? KP!Ѝ 0 R, =P 0 0 0000(000fb 0 0h  D0CD B P@0(M00H\`! )9d7@-@ P<0# 0C B<00# 0Ls:p@-NgMV@ 0SO P<A QT1 R> P  `R= <0 0C 0` 1 !YЍp@ #  !$$("($  $ 8PDPUr P t300#80 00PTj /NPzލ2"6>"12| 0"+@PI p000SP 9  ~  ]  !衟  ?Y@(OF JP !0 0!0  `1Xpl80T0 R* %P `4!0 0z?  R* PTl0T0u 0<`00t0z5dN` 0  0< h0N`00@0@ `! Թ6r=̺THp@-FM@X00 `gPP `0 T03P0 TTN PЍp-F M0X @P ЍR !\ A\ \ /R> R00S> /P> R R  R/R00 $1@-@MTpP`4 ^P `P[0@(@0  Ѝ@o/00S!R "R00S00S/@o/`P,P0 _`! $@- M ` tPP0@rS sS0S0S pW  xP/ 0S" Ѝ0xS Ѝ0S0SpW  ]P >P 00 Ѝ( s#!<$00 Ѝ!p@-@ @PP PPpPp 06/p@-=@5 `P K/( x = PJRP600S06pp@-@6<5 `P ( = JTP600S06p:@-6S- Q S "Q S "Q S "# R  5(   $ G-@MʌoV6 \3 ^0Qp0+]S P[ 0  0:?S>Y* )0Qp0P@@ Ѝ]SP0 S-0xSP L1D10B0S7 000 h0:?S*  0 $7P(0S,0S0S0 R Q 0  00?H009  10( ((K0 FON8"Tp6`-$M00   I$ЍO-iMP1 0\ܑ1ᳰ0[Z P`4 `0 \S:0pP@[000M00L N0 P배@[<`$pPP$ <R $  R  8LMN0110 S .`0000000 S  8iߍiߍY0h hh^-@0~ [P r0  뀻6O-@iMP n!Ა Y k QM `PR!I 0SI x1 `0p@ 0E 0 0P0H \S00S% P T 0 Ⲡ<Z $0M A@`N @ V<$pPP@:0 S@0 iߍ iߍ!0S0P 3P00  0 0 -^ꀻ600//@-  0P@@- @0P00'00p@- P@M00p/ 40@-0,="@P00/  0@- @謹,0@-@ 000/ p@- PM@ `@0` 0ᚶ 0 `Ѝpp@-C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{ *& *Z>>*SJ51:3//// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$// *R:0",SJ413//ar$//SRQPM`-Ѝ /@-rQC-P@P33<:Soo Uo oL| L~ l2xlUT33:0@T3 P\ 0f `@TP@P@P`V UT*@P`V4l5|h 5n0 6R@PY@G-L`LP`P`FpFa@@0 3/V,/@-!w"M/var/lock/bts_rf_lockNot starting BTS due to RF_LOCK file present main.cSet global status #%d to %d (%04llx -> %04llx), LEDs: ACT %d Model specific options: -w --hw-version Print the targeted HW Version -M --pcu-direct Force PCU to access message queue for PDCH dchannel directlywMsysmobts was compiled for hw version 2.Abis closehw-versionpcu-direct"(6!*1l2hmsgb_l2len(msg) <= sizeof(l1p->u.phDataReq.msgUnitParam.u8Buffer)%s %s PH-DATA.req(%s) %s %s MQ_L1_WRITE queue full. Dropping msg. fl1h->phy_inst%s Rx PH-RTS.ind SAPI=%s %s MQ_L1_WRITE queue full. Dropping msg. %s PH-DATA-INDICATION for unknown sapi %s (%d) %s Rx PH-DATA.ind %s (hL2 %08x): %s, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s Rx PH-RA.ind, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s PH-RACH-INDICATION has %d bits msgb(%p): No room for primitive msgb(%p): No room for primitive data sys_primunknown MPH-INFO.req %d unknown prim %d op %d Rx L1 prim %s on queue %d l1_if.c:82Rx SYS prim %s Tx RF-MUTE.req (%d, %d, %d, %d, %d, %d, %d, %d) Ignoring Clock Calibration for selected %s clock Using external attenuator. %u.%u dsp %u.%u.%u fpga %u.%u.%uBTS band %s not supported by hw Operating without calibration; unable to load tables! Tx SET-TRACE-FLAGS.req (0x%08x) MQ_SYS_WRITE queue full. Dropping msg Rx L1-RESET.conf (status=%s) L1-RESET.conf with status %s L1-RESET failuresysmoBTSv2 L1IF compiled against API headers v%u.%u.%u struct femtol1_hdlFailed to read from EEPROM. Read clock calibration(%d) from EEPROM. Unable to read band support from EEPROM, assuming all bands Clock source defaulting to GPS 1PPS on sysmoBTS 2050 l1_if.c:1742l1_if.c:1749RfClockInfo iClkCor=%d/clkSrc=%s Err=%d/ErrRes=%d/clkSrc=%s Calibrating GPS against GPS doesn not make sense. No reference clock set. Please reset first. Couldn't determine the clock difference. Cannot open L1 interface Unknown/Unsupported sysmoBTS Model Number %u Assuming 1002 for sysmoBTS Model number %u Cannot determine nominal transmit power. Assuming 23dBm. lchan2lch_parJJ$J@J A\A,AA@@         oml.c:1115%s : %s tch_mode=0x%02x oml.c%s Channel mode %s is not supported! %s MPH-CONFIG.conf (%s) setTxPower %f dBm Rx RF-MUTE.conf status=%s RF-MUTE failureACTIVE ACT_PENDING DEACT_PENDING cnf->u8Tn < TRX_NR_TS%s %s Rx mphConnectCnf flags=%s%s%s DSP L1 is no longer sending primitives! %s Rx mphDisconnectCnf BSIC=0x%08xBS_AG_BLKS_RES=%u MS Power Level 0x%02xamrCmiPhase=0x%02x amrInitCodec=0x%02x (%x %s Requested TS connect as %s, expected a specific pchan instead %s pchan=%s ts_connect_as(%s) logChComb=%s Close TRX %u %s cannot determine L1 SAPI oml.c:1064%s MPH-ACTIVATE.req (hL2=0x%08x, %s %s SET_CIPHERING (ALG=%u %s) oml.c:1356%s MPH-CONFIG.req (%s) cfgParams Tn=%u, subCh=%u, dir=0x%x oml.c:738oml.c:746%s all SAPIs already released? %s MPH-DEACTIVATE.req (%s Unimplemented command type %d oml.c:757struct sapi_cmd%s act failed mark broken due status: %d Queue is now empty. More pending.oml.c:785%s End of SAPI cmd queue encountered.%s Failed to find lchan for hLayer3=0x%x %s MPH-ACTIVATE.conf (%s Successful activation of L1 SAPI %s on TS %u Error activating L1 SAPI %s on TS %u: %s %s Got activation confirmation with empty queue %s Confirmation mismatch (%d, %d) (%d, %d) RX_REQ -> RX_CONF RX_CONF_TX_REQ -> RXTX_CONF RXTX_REQ -> RX_CONF_TX_REQ unhandled state %u %s Got ciphering conf with empty queue %s MPH-DEACTIVATE.conf (%s Successful deactivation of L1 SAPI %s on TS %u Error deactivating L1 SAPI %s on TS %u: %s %s Got de-activation confirmation with empty queue %s Trying to activate lchan, but commands in queue %s is now broken. Stopping the release. Rx %s, status: %s ====> trying to activate lchans of BCCH Rx MPH-INIT.conf (status=%s) Rx MPH-INIT.conf status=%s MPH-INIT failureUnsupported GSM band %s Init TRX (ARFCN %u, TSC %u, RxPower % 2f dBm, TxPower % 2.2f dBm Discarding adm change command: pending procedure on RC %d %s modifying channel for handover %s already in release request state. %s TS disconnect Set NB TSCSet Tx power levelSet logical channel paramsConfigure ciphering paramssysmobts_vty.c:143 %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-thresh lower %u upper %u'.%sactivatePHY Clock Source: %s%sCannot find PHY link %u%sCannot find PHY instance %u%sDSP Version: %u.%u.%u, FPGA Version: %u.%u.%u%sGSM Band Support: enableddisabledFemto L1 DSP trace flags:%sDSP Trace %-15s %s%s nominal-tx-power %d%s dsp-trace-flag %s%s clock-calibration eeprom%s clock-calibration %d%s trx-calibration-path %s%s clock-source %s%s|trx <0-0> dsp-trace-flag (Transceiver related commands TRX number DSP Trace Flag no trx <0-0> dsp-trace-flag (Negate a command or set its defaults Transceiver related commands TRX number DSP Trace Flag dsp-trace-flag (no dsp-trace-flag (Negate a command or set its defaults DSP Trace Flag no trx <0-0> <0-7> loopback <0-1>Negate a command or set its defaults Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> <0-7> loopback <0-1>Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> rf-clock-info correctTransceiver related commands TRX number RF Clock Information Apply trx <0-0> rf-clock-info resetTransceiver related commands TRX number RF Clock Information Reset the counter trx <0-0> tx-power <-110-100>Transceiver related commands TRX number Set transmit power (override BSC) Transmit power in dBm trx <0-0> <0-7> (activate|deactivate) <0-7>Transceiver related commands TRX number Timeslot number Activate Logical Channel Deactivate Logical Channel Logical Channel Number show phy <0-255> instance <0-255> system-informationShow running system information Transceiver related commands TRX number Display information about system HIDDENNegate a command or set its defaults Transceiver related commands TRX number Transceiver related commands TRX number show dsp-trace-flags trx <0-0>Show running system information Transceiver related commands TRX number Display the current setting of the DSP trace flagsshow phy <0-255> clock-sourceShow running system information Transceiver related commands TRX number Display the clock source for this TRXnominal-tx-power <0-100>Set the nominal transmit output power in dBm Nominal transmit output power level in dBm uplink-power-target <-110-0>Obsolete alias for bts uplink-power-target Target uplink Rx level in dBm trx-calibration-path PATHSet the path name to TRX calibration data Path name clock-source (tcxo|ocxo|ext|gps)Set the clock source value Use the TCXO Use the OCXO Use an external clock Use the GPS pps clock-calibration <-4095-4095>Set the clock calibration value Offset in PPB clock-calibration defaultSet the clock calibration value Default Clock DAC value clock-calibration eepromUse the eeprom clock calibration value       %s RTP IN: %s tch.cRTP HR frame length %u != expected %u Unhandled DTX DL AMR FSM state %d %s unable to parse RTP payload %s RTP->L1: %s %s %s chan_nr %d Rx Payload size 0 L1P-to-RTP%s %s DTX: received ONSET from L1 (%d bytes) %s %s DTX: received SID_FIRST_P1 from L1 (%d bytes) %s %s DTX: received SID_FIRST_P2 from L1 (%d bytes) %s %s DTX: received SID_FIRST_INH from L1 (%d bytes) %s %s DTX: received SID_UPDATE_INH from L1 (%d bytes) %s %s %s Rx Payload Type %s is unsupported L1 HR frame length %u != expected %u %s %s %s Rx Payload Type %s incompatible with lchan %s %s chan_nr %d Rx FACCH  %s fileeepromL1 calibration table %s loaded (src: %s) L1 calibration table loading complete! No band_support?!? calib_rxu_850.cfgcalib_rxu_900.cfgcalib_rxu_1800.cfgcalib_rxu_1900.cfgcalib_rxd_850.cfgcalib_rxd_900.cfgcalib_rxd_1800.cfgcalib_rxd_1900.cfgcalib_tx_850.cfgcalib_tx_900.cfgcalib_tx_1800.cfgcalib_tx_1900.cfgr+/sys/bus/i2c/devices/i2c-1/1-0050/eepromeeprom fopeneeprom fseekeeprom fread %.4x| %.2x ;123456789:<=>@ABCDEFGHIJKLMNOPQRSUVWXYZ[\]^_`aaaaaaaaa b b/sys/devices/platform/i2c_davinci.1/i2c-1/1-0050/eepromComputed CRC(%d) wanted CRC(%d) sysmoBTS 1002sysmoBTS 1002+GPS+PoEsysmoBTS 2050 (master)sysmoBTS 2050 (slave)sysmoBTS 2050 (unknown)Unknownethaddrclk-factorytemp-dig-maxtemp-rf-maxserial-nrhours-runningboot-countkeymodel-nrmodel-flagstrx-nrError setting new correction value.successsysmobts_ctrl.c%d,%s,%d,%d,%sclock-correctionclock-infoprim_size_for_queueread_dispatch_oneDdddddccd$dmsgb->l1herror writing to L1 msg_queue: %s l1_transp_hw.cshort write to L1 msg_queue: %u < %u writing on a wrong queue: %d false1l_fdfailed to read from fd: %s [%d] unable to open %s for reading: %s [%d] unable to open %s for writing: %s /dev/msgq/superfemto_arm2dsp/dev/msgq/gsml1_sig_arm2dsp/dev/msgq/gsml1_tch_arm2dsp/dev/msgq/gsml1_pdtch_arm2dsp/dev/msgq/superfemto_dsp2arm/dev/msgq/gsml1_sig_dsp2arm/dev/msgq/gsml1_tch_dsp2arm/dev/msgq/gsml1_pdtch_dsp2arm0h8h@h00@0LheTh`h hh |h h@f`ffff g,gPglg g g h,shadow(bts=%u,trx=%u,ts=%u%s)PDCH(bts=%u,trx=%u,ts=%u%s,pchan=%s as %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s switching %s -> %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s)Physical Channel not configuredFCCH + SCH + BCCH + CCCH (Comb. IV)FCCH + SCH + BCCH + CCCH + 4 SDCCH + 2 SACCH (Comb. V)TCH/F + FACCH/F + SACCH (Comb. I)2 TCH/H + 2 FACCH/H + 2 SACCH (Comb. II)8 SDCCH + 4 SACCH (Comb. VII)Packet Data Channel for GPRS/EDGEDynamic TCH/F or GPRS PDCHUnknown / Unsupported channel combinationFCCH + SCH + BCCH + CCCH + CBCH + 3 SDCCH + 2 SACCH (Comb. V)7 SDCCH + 4 SACCH + CBCH (Comb. VII)Dynamic TCH/F or TCH/H or SDCCH/8 or GPRS PDCHNONECCCHCCCH+SDCCH4SDCCH8TCH/F_PDCHUNKNOWNCCCH+SDCCH4+CBCHSDCCH8+CBCHTCH/F_TCH/H_SDCCH8_PDCHBTS process timersabisAbis (RSL) related timerssysinfo.c%s: Unable to determine actual BS_AG_BLKS_RES value as SI3 is not available yet, fallback to 1 %s: Unable to determine actual NCH Position value as SI1 is not available yet. Disabling GPRS Indicator in SI (No PCU connected) Enabling GPRS Indicator in SI (PCU connected) Cannot parse SI4, hence not patching GPRS indicator $WOMLOC=%s INST=(%02x,%02x,%02x)msgb(%p): Not enough headroom msgb_push (allocated %u, head at %u < want headroom %u, len %u, tailroom %u) msgb->l3h%s: Sending FOM failed (no related BTS object found) %s: Tx %s %s: Sending %s to BSC: %s AVAIL STATE %s -> %s %s OPER STATE %s -> %s %s ADMIN STATE %s -> %s msgb(%p): msgb too small to pull %u (len %u) %s: Sending FOM NACK with cause %s %s: Sending FOM ACK %s: Failed to send ACK/NACK %s: Rx SET BTS ATTR New value for Attribute not supportedGiven ARFCN %u is not supported%s: Given ARFCN %u is not supported NM_ATT_START_TIME Attribute not supportedoml_bts_attroml.c:940oml.c:945%s: WARNING: Radio Link Timeout explicitly disabled, only use this for lab testing! %s: Given Conn. Failure Criterion not supported. Please use criterion 0x01 with RADIO_LINK_TIMEOUT value of 4..64 %s: Ignoring T200 BTS attribute. %s: T3105 must have a value != 0 %s: SET BTS ATTR: this BTS model does not support TSC %u != BSIC-BCC %u (TSC %u) %s: Rx SET RADIO CARRIER ATTR New value for Set Radio Attribute not supportedoml_trx_attroml.c:1138oml.c:1143%s: Set RF Max Power Reduction to %d dBm %s: Expecting only one ARFCN, because hopping not supported Given ARFCN %u is unsupported%s: Given ARFCN %u is unsupported OML-ack_nackUnknown/unhandled PCHAN type: %u %s %s: Rx SET CHAN ATTR New value for Set Channel Attribute not supported%s: SET CHAN ATTR: Frequency hopping not supported %s: SET CHAN ATTR: HSN and/or MAIO is missing: hsn=%u, maio=%u %s: SET CHAN ATTR: ARFCN list is missing %s: SET CHAN ATTR: ARFCN list is too long %s: SET CHAN ATTR: ARFCN list has odd length %s: SET CHAN ATTR: Starting time not supported oml_chan_attr%s: SET CHAN ATTR: invalid attribute value, rc=%d oml.c:1363oml.c:1369%s: SET CHAN ATTR: invalid Chan Comb 0x%x (pchan=%s, handle_chan_comb() returns %d) oml.c:1379%s: SET CHAN ATTR: this BTS model does not support TSC %u != BSIC-BCC %u oml.c:1397%s: SET CHAN ATTR (TSC=%d pchan=%s hsn=%u maio=%u chan_num=%uInitializing OML attribute definitions %s: Rx GET ATTR %s: Get Attributes for unknown Object Instance Get Attribute parsing failureGet Attribute without Attribute Listosmobtsmsgb(%p): msgb too small to get %u (len %u) %s: O&M Get Attributes [%u], %s is unsupported %s: Responding to O&M Get Attributes message with NACK 0%x %s: Rx CHG ADM STATE %s: Rx CHG ADM STATE: error during TLV parse %s: Rx CHG ADM STATE: no ADM state attribute %s: ADM state already was %s %s: ADM STATE %s -> %s %s: Rx IPA SET ATTR New value for IPAC Set Attribute not supported oml_ipa_attroml.c:1849Manufacturer O&M message too short Manufacturer OML message != ipaccess not supported msgb(%p): Negative length is not allowed Unexpected BTS %d in manufacturer O&M %s (exp. 0 or 0xFF)%s: TLV parse error %d %s: Rx IPACCESS(0x%02x): %s Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x for unknown TRX_NR=%u %s: Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x unknown Manufacturer O&M msg_type 0x%02xOML message too short Unsupported segmented O&M message Short OML message: %u < %u Formatted O&M message too short%s: GET ATTR with off-by-3 length: Fixing up for OS#3799 %s: OML message with %u extraneous bytes at end: %s Unexpected BTS %d in formatted O&M %s (exp. 0 or 0xFF)%s: Rx OPSTART %s: ... automatic ACK, OP state already was Enabled mo->fiunknown Formatted O&M msg_type 0x%02xunknown O&M msg_disc 0x%02x   27)L4m:Vs8}@}P}`}p}}}}}}(}     Hsy~~\yd||||DX4@`l̀$@LhxȁЁ(HTp|Ђ(h؃ 8|ĄUpdated AGCH max queue length to %d bts.cstruct gsm_btsbts%dgprs_cell%d-0bts.c:287bts->features != NULL/tmp/pcu_btsbts->smscb_basic.ctrsbts->smscb_extended.ctrsrc == 0Main link established, sending NM Status AGCH: too many messages in queue, refusing message type %s, length = %d/%d Unhandled RSL channel type=0x%02x/rate=0x%02x %s BCCH carrier power reduction is not supported by this BTS model %s BCCH carrier power reduction value (%u dB) is incorrect or out of range %s BCCH carrier power reduction: %u dB (%s) DSP/HW based MS Power Control LoopMeasurement and Payload data combinedOML RadioChannel MO depends on RadioCarrier MOUplink interference measurementsBTS_TYPE_VARIANTBTS_SUB_MODELTRX_PHY_VERSIONunknownosmo-bts-lc15osmo-bts-oc2gosmo-bts-octphyosmo-bts-sysmoosmo-bts-trxosmo-bts-virtualosmo-bts-omldummyTime to wait between Channel Activation and dispatching a cached early Immediate AssignmentTime after which osmo-bts exits if regular ramp down during shut down process does not finish (s)Time after which osmo-bts exits if requesting transceivers to stop during shut down process does not finish (s)cbchcell broadcast channelcbch:rcvd_queuedReceived + queued CBCH messages (Abis)cbch:rcvd_droppedReceived + dropped CBCH messages (Abis)cbch:sent_singleSent single CBCH messages (Um)cbch:sent_defaultSent default CBCH messages (Um)cbch:sent_nullSent NULL CBCH messages (Um)base transceiver stationpaging:rcvdReceived paging requests (Abis)paging:dropDropped paging requests (Abis)paging:drop-psDropped paging requests (PS/PCU)paging:sentSent paging requests (Um)paging:congPaging congestion detected (Abis)rach:rcvdReceived RACH requests (Um)rach:dropDropped RACH requests (Um)rach:handoverReceived RACH requests (Handover)rach:vgcsReceived RACH requests (VGCS)rach:csReceived RACH requests (CS/Abis)rach:psReceived RACH requests (PS/PCU)agch:rcvdReceived AGCH requests (Abis)agch:sentSent AGCH requests (Abis)agch:deleteSent AGCH DELETE IND (Abis)rtp:rx:totalTotal number of received RTP packetsrtp:rx:markerNumber of received RTP packets with marker bit setrtp:rx:drop:preenTotal number of received RTP packets dropped during preeningrtp:rx:drop:loopbackTotal number of received RTP packets dropped during loopbackrtp:rx:drop:overflowTotal number of received RTP packets dropped during DL queue overflowrtp:rx:drop:v110_decTotal number of received RTP packets dropped during V.110 decodertp:tx:totalTotal number of transmitted RTP packetsrtp:tx:markerNumber of transmitted RTP packets with marker bit set bts_sm.c:44struct gsm_bts_smbts_smgprs_nse0gprs_nsvc%d-%dstruct gsm_bts_trx_tsbts_trx.cts != NULLtrx->ts[tn].mo.fi != NULLbts_trx.c:137bts_trx.c:140struct gsm_bts_trxbts%d-trx%d%s-ts%u(trx=NULL)(bts=%d,trx=%d)%u/%u/%u%s RSL link up Failed to establish RSL link (%d) GHrsl_rx_paging_cmdrsl_rx_sms_bcast_cmdrsl_rx_notification_cmdrsl_rx_osmo_etws_cmdrsl_rx_bs_pwr_ctrlrsl_rx_encr_cmdrsl_rx_ms_pwr_ctrlrsl_rx_meas_preproc_dftrsl_rx_bcch_inforsl_rx_ipac_dlcxrsl_rx_mode_modifrsl_rx_sacch_fillrsl_rx_sacch_inf_modrsl_rx_ipac_XXcxrsl_rx_imm_assrsl_rx_chan_activ%s Channel Mode IE is not present rsl.c%s Training Sequence IE is not present %s Channel Mode IE contains unknown 'Channel rate and type' value 0x%02x %s Channel Mode IE contains an unknown/unhandled combination of 'Speech or data indicator' 0x%02x and 'Speech coding algorithm/data rate' 0x%02x %s Channel type=0x%02x/mode=%s is not supported by the PHY %s BTS doesn't support cipher %s %s Encryption Info cannot have len=%d %s Setting lchan cipher algorithm %s %sunknown chan_nr=0x%02x %s %smismatching chan_nr=0x%02x %s This PHY does not support lchan TSC %u != BSIC-TSC %u, sending NACK %s Missing MultiRate conf IE (TCH mode is %s) %s Unexpected MultiRate conf IE (TCH mode is %s) %s Error parsing MultiRate conf IE RSLACTDEACT%s Tx PDCH %s NACK (cause = 0x%02x) %s (ss=%d) %s Tx CHAN ACT ACK 0x%02x: Tx MODE MODIFY NACK (cause = 0x%02x) Sending Channel Activated NACK: cause = 0x%02x Tx RSL Error Report: cause = 0x%02x size >= headroomRSL Radio Link Layer message too short Rx RLL %s for unknown lchan %s Rx RLL %s for lchan which isn't active %s Rx RLL %s Abis -> LAPDm RSL rx RLL: %s %s(): rsl_tlv_parse() failed BTS paging table is full%s %s(): chan nr is not Downlink CCCH FACCH copyETWS Primary Notification OFF rsl.c:981ETWS Primary Notification: %s rsl.c:991rsl.c:993%s Fast Power Control is not supported %s Failed to parse BS Power Parameters IE %s BS POWER CONTROL: attenuation change %u -> %u dB %s Fwd RSL ENCR CMD (Alg %u) to LAPDm %s Rx MS POWER CONTROL %u %s Failed to parse MS Power Parameters IE %s Unable to calculate power levels to dBm: %u -> %d, %u -> %d %s Rx Measurement Pre-processing Defaults rsl.c:1348rsl.c:1353rsl.c:1366rsl.c:1371struct gsm_power_ctrl_params Rx RSL SI 0x%02x not supported. Truncating received Full BCCH Info (%u -> %zu) for SI%s Rx RSL BCCH INFO (SI%s, %u bytes) Rx RSL SI2quater count updated: %u -> %d Rx RSL SI2quater with index %u > count %u Rx RSL SI2quater with impossible parameters: index %u, count %ushould be <= %u BCCH INFO Rx RSL BCCH INFO (SI%s) RX RSL Disabling BCCH INFO (SI%s) %s RSL Tx %s %s RSL Tx IPAC_DLCX_NACK %s RSL Tx IPAC_DLCX_ACK Closing RTP socket on DLCX %s Tx MODE MODIF ACK Rx SACCH SI 0x%02x not supported. Truncating received SI%s (%u -> %zu) to prepend LAPDM UI header (2 bytes) Rx RSL SACCH FILLING (SI%s, %u bytes) Rx RSL Disabling SACCH FILLING (SI%s) %s Starting time not supported %s Rx SACCH SI 0x%02x not supported. %s Rx RSL SACCH FILLING (SI%s) %s Rx RSL Disabling SACCH FILLING (SI%s) CRCXMDCX0.0.0.0%s IPAC_%s: connect_ip=%s connect_port=%u speech_mode=%u payload_type=%u payload_type2=%u osmux_cid=%u rtp_extensions=%u %s Rx RSL IPAC %s, RTP_PT and RTP_PT2 in same msg !?! csd_fmt_d=%d csd_fmt_ir=%d %s Rx RSL IPAC %s, csd_fmt_d=%d is not supported %s Rx RSL IPAC XXcx without Osmux CIDgoes against configured Osmux policy 'only' %s Rx RSL IPAC MDCX, but we have no RTP socket! %s Rx RSL IPAC XXcx with Osmux CIDgoes against configured Osmux policy 'off' %s Rx RSL IPAC MDCX with Osmux CID, CRCX was configured as RTP! %s RSL Tx IPAC_%s_ACK (local %s:%u, remote %s:%u) Tx RSL RF RESource INDication Early IA check: %s (ss=%d) PDCH release: not in PDCH mode %s PCU rel ack for unexpected lchan kind %s %s not sending REL ACK %s (ss=%d) %s Tx CHAN REL ACK %s Sending HANDOver DETect %s Sending LISTENER DETect %s Sending TALKER DETect %s not sending CHAN ACT %s %s missing Activation Type %s error: lchan is not available, but in state: %s. %s error: reactivation on inactive lchan. %s rx chan activ but TS not in nm_state oper=ENABLED avail=OK, nack! chan nr 0x%x not covered by dyn_pchan_from_chan_nr() %s rx chan activ %s dyn_ts_l1_reconnect %s Cannot reconnect as pchan %s %s Disconnect lchan->pending_chan_activ == NULL%s Missing Handover Reference IE %s BS Power attenuation %u dB %s Error parsing SACCH INFO IE %s chan_nr=%s type=0x%02x=%s mode=%s %s Cannot send act ack: %d %s Activate via PCU %s Activate via PCU when PCU connects %s Sending Connection Failure: cause = 0x%02x Sending Channel Required %s Sending RTP delete indication: cause = %s %s Internal Error: both PDCH ACT and PDCH DEACT pending PDCH %s on dynamic TCH/F_PDCH returned error %d %s %s switched to %s mode (ts->flags == %x) %s Tx PDCH %s ACK Failed to transmit PDCH %s ACK, rc %d %s PDCH DEACT operation: channel disconnected, will reconnect as TCH %s PDCH ACT operation: channel disconnected, will reconnect as PDTCH %s Disconnected %s Dyn TS disconnected, but invalid desired pchan: %s %s Connect %s PDCH ACT IPA operation failed (%d) in bts model %s PDCH DEACT error: timeslot connected, so expecting lchan type TCH/F, but is %s %s PDCH DEACT operation: timeslot connected as TCH/F %s PDCH ACT error: timeslot connected, so expecting lchan type PDTCH, but is %s %s PDCH ACT operation: timeslot connected as PDTCH %s PDCH ACT OSMO operation failed (%d) in bts model %s Connected %s chan_num:%u Tx MEAS RES valid(%d), flags(%02x) %s Send Meas RES: NUM:%u, RXLEV_FULL:%u, RXLEV_SUB:%u, RXQUAL_FULL:%u, RXQUAL_SUB:%u, MS_PWR:%u, UL_TA:%u, L3_LEN:%u, TimingOff:%u []msg%s (%s) is not active. Dropping message (len=%u): %s %s RLL EST IND without contention resolution. %s Short GPRS SUSPEND REQ received, ignoring %s Fwd GPRS SUSPEND REQ for TLLI=0x%08x to PCU %s Fwd RLL msg %s from LAPDm to A-bis %s Scheduling %s to L3 in next associated TCH-RTS.ind %s Dropping pending release indication message ACT DEACTRSL message too short RSL Common Channel Management message too short RSL rx CCHAN: Rx RSL %s for unknown lchan %s Rx RSL %s %s unimplemented RSL cchan msg_type %s %s undefined RSL cchan msg_type 0x%02x RSL Dedicated Channel Management message too short %s ss=%d Rx RSL %s %s ss=%d state=%s Rx RSL RF Channel Release, but is already inactive; just ACKing the release %s Request to PDCH %s, but PDCH%s%s is still pending %s Request to PDCH %s, but lchan is still in state %s %s Attempt to PDCH %s on TS that is not a TCH/F_PDCH (is %s) %s Request to PDCH %s, but is already so %s unimplemented RSL dchan msg_type %s %s undefined RSL dchan msg_type 0x%02x undefined RSL TRX msg_type 0x%02x RSL ip.access message too short %s unsupported RSL ip.access msg_type 0x%02x unknown RSL msg_discr 0x%02x RSL rx DCHAN: RSL rx IPACC: 08h(0 00 0 00 @0 \0 T00th0Copyright (C) 2010-2011 by Harald Welte, Andreas Eversberg and On-Waves Copyright (C) 2011-2022 by sysmocom - s.f.m.c. GmbH License AGPLv3+: GNU AGPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'no rxlev-avg'.%s%% rtp bind-ip is now deprecated%s%*sLower threshold (L_%s_XX_P): %u%s%*sUpper threshold (U_%s_XX_P): %u%s%*sLower threshold comparators: P%u=%02u / N%u=%02u%s%*sUpper threshold comparators: P%u=%02u / N%u=%02u%s%*sPre-processing algorithm: unweighted average%sweighted average%smodified median%sEWMA (alpha=%u)%sdisabled (pass-through)%sunknown%s%*sPre-processing parameters: Hreqave=%u / Hreqt=%u%s%*sPower control interval: %u ms (every %u SACCH block(s))%s%*sPower increase step size: %u%s%*sPower reduce step size: %u%s%*sRxLev measurement processing:%sRXLEV%*sRxQual measurement processing:%sRXQUAL%*sC/I measurement processing (FR/EFR):%sCI_FR%*sC/I measurement processing (HR):%sCI_HR%*sC/I measurement processing (AMR-FR):%sCI_AMR_FR%*sC/I measurement processing (AMR-HR):%sCI_AMR_HR%*sC/I measurement processing (SDCCH):%sCI_SDCCH%*sC/I measurement processing (GPRS):%sCI_GPRS%% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-avg algo osmo-ewma beta %s'.%s%% Range end port (%u) must be greater than the range start port (%u)!%s%% Range must begin at an even port number! (%u is odd)%s%% Range must end at an odd port number! (%u is even)%s%% No such instance %u%s%% Unable to create phy%u instance %u%sphy %u%s%% Unknown BTS number %u (num %u)%s%% No such BTS (%d)%s%% Incorrect BCCH power reduction value, an even number is expected%s%% BCCH carrier power reduction operation mode is not supported for BTS (%d)%s%% can't find BTS '%s'%sinfinite%% INFINITE RADIO LINK TIMEOUT, USE ONLY FOR BTS RF TESTING%sonlyskip-nullrfc5993test message sent from VTY%% phy%s does not exist%s%% phy%s instance %s does not exit%s%% phy%s instance %s is already bound to %s%s%% The next unused TRX number is %u%s%% Unable to allocate TRX %u%svty.c:2338%% This command requires restart%svty.c:2321localhost/opt/poky-sdk/2.3.4/sysroots/armv5te-poky-linux-gnueabi/usr/local/jenkins-build/inst-osmo-bts-sysmo/include/osmocom/core/utils.h:127%% duplicate BSC (A-Bis/OML) ip address configured ('%s')%sstruct bsc_oml_hostvty.cbsc_oml_hostbsc_oml_host->addrOper '%s', Admin '%s', Avail '%s'%s(null)fall-backfrom BSCconnecteddisconnectedTRX %u of BTS %u is on ARFCN %u%sDescription: %s%s RF Nominal Power: %d dBm, reduced by %u dB, resulting BS power: %d dBm%s BS Power control parameters (%s):%s MS Power control parameters (%s):%s NM State: RSL State: %s%s Baseband Transceiver NM State: IPA stream ID: 0x%02x%sBTS %u, TRX %u, Timeslot %u, phys cfg %s, TSC %u (%s mode)%% can't find TRX '%s'%s%% can't find TS '%s'%ssapi >= 0sapi <= 31vty.c:2703uint16_tosmo%% BTS model 'osmo-bts-trx' has no DSP/HW MS Power Control support, consider updating your configuration file!%s%% This BTS model has no DSP/HW MS Power Control support%s%% Could not resolve logical channel%s%% BAND '%s' is not a valid GSM band%svty.c:673%% no such BSC (A-Bis/OML) ip address configured ('%s')%s as %s switching %s -> %sshadowprimaryBTS %u, TRX %u, Timeslot %u (%s) %s, Lchan %u, Type %s, State %s - RXL-FULL-ul: %4d dBm%s%d SACCH blocks%% this channel has no active RTP stream%s%% error setting jitter parameters: %s%s%% jitter parameters set: %d%sbs-power-ctrldynamiccurrent Error reason: staticendisBTS %u, TRX %u, Timeslot %u (%s), Lchan %u: Type %s%s Osmocom Dyn TS: IPACC Dyn PDCH TS: State: %s%s%s%s Channel Mode / Codec: %s%s CSD mode: %s%s AMR Multi-Rate Configuration: ICMI=%u, Start Mode=%u gsm48=%02x%02x%s AMR Mode %u (%s), threshold=%u, hysteresis=%u%s Bound IP: %s Port %u CONN_ID=%u Osmux_CID=%u%s RTP_TYPE2=%u%s Conn. IP: %s Port %u SPEECH_MODE=0x%02x RTP_TYPE=%u%s LAPDm SAPIs: DCCH %c%c, SACCH %c%c%s Valid System Information: 0x%08x%s MS Timing Offset: %d, propagation delay: %d symbols %s Ciphering A5/%u State: %s, N(S)=%u%s RTP/PDCH Loopback Enabled%s Radio Link Failure Counter 'S': %d%s Interference: %d dBm (band %d)%s%*sBS (Downlink) Power Control (%s mode):%s%*sChannel reduction: %u dB (max %u dB)%*sTRX reduction: %u dB%s%*sActual / Nominal power: %d dBm / %d dBm%s%*sPower Control parameters:%s%*sMS (Uplink) Power Control (%s):%s%*sCurrent power level: %u, %d dBm (max %u, %d dBm)%*sACCH repetition:%s%*sEnable RXQUAL threshold: %u%s%*sEnable RXQUAL threshold: (none, alway on)%s%*sDL-FACCH:%s%*sretramsit all LAPDM block types%s%*sretramsit only LAPDM command blocks%s%*sno retransmission (disabled)%s%*sretransmission currently active%s%*sretransmission currently inactive%s%*sDL-SACCH:%s%*sretramsit all SACCH blocks for SAPI=0%s%*sUL-SACCH:%s%*sTemporary ACCH overpower:%s%*sOverpower value: %u dB%s%*sSACCH overpower: %sabled%s%*sFACCH overpower: %sabled%s%*sRxQual threshold: disabled (overpower is always on)%s%*sRxQual threshold: %u%sno ts101318offbts %u%s description %s%s band %s%s auto-band%s ipa unit-id %u %u%s rtp jitter-buffer %u oml remote-ip %s%s adaptive rtp port-range %u %u%s rtp ip-dscp %d%s rtp socket-priority %d%s rtp continuous-streaming%s %srtp internal-uplink-ecu%s rtp hr-format %s%s paging queue-size %u%s paging lifetime %u%suplink %s-power-target %d hysteresis %d %s-power-filtering algo ewma beta %u%s no %s-power-filtering%s agch-queue-mgmt threshold %d low %d high %d%s gsmtap-remote-host %s%s gsmtap-local-host %s%s gsmtap-sapi %s%s gsmtap-rlp skip-null%s gsmtap-rlp%s min-qual-rach %d%s min-qual-norm %d%s max-ber10k-rach %u%s pcu-socket %s%s pcu-socket-wqueue-length %u%s supp-meas-info toa256%s smscb queue-max-length %d%s smscb queue-target-length %d%s smscb queue-hysteresis %d%s%sosmux%s%s use on%sonly%soff%s%s local-ip %s%s%s local-port %u%s%s batch-factor %d%s%s batch-size %u%s%s dummy-padding %s%s trx %u%s user-gain %u mdB%s power-ramp max-initial %d mdBm%s power-ramp step-size %d mdB%s power-ramp step-interval %d%s ms-power-control %s%s ta-control interval %u%s phy %u instance %u%s[BTS %u, RAC %u, NSEI %u, BVCI %u%s Cell NM state: NSE NM state: NSVC%u (NSVCI %u) NM state: Address: r=%s%s%s:%u<->l=%s%s%s:%u%s%% can't find BTS %s%s%% can't find TRX %s%s%% can't find TS %s%s%% can't find LCHAN %s%sBTS %u is of type '%s', in band %s, has CI %u LAC %u, BSIC %u and %u TRX%s Description: %s%s Unit ID: %u/%u/0, OML Stream ID 0x%02x%s Site Mgr NM State: PCU version %s connected%s Paging: Queue size %u, occupied %u, lifetime %us%s AGCH: Queue limit %u, occupied %d, dropped %llu, merged %llu, rejected %llu, ag-res %llu, non-res %llu%s CBCH queue target: %d, hysteresis: %d, maximum: %d%s CBCH backlog queue length (BASIC): %d%s CBCH backlog queue length (EXTENDED): %u%s Paging: queue length %d, buffer space %d%s OML Link state: %s.%s PH-RTS.ind FN advance average: %d, min: %d, max: %d%s Radio Link Timeout (OML): %s%s Radio Link Timeout (OVERRIDE): %s%s BCCH carrier power reduction: %u dB%s TRX %u%s phy %d %s (%s) Features:%s %03u %-40s%s (not available)%s BTS model specific (internal) flags:%s%% Cannot find PHY link number %d%s%% Cannot find PHY instance number %d%sgsmtap-sapi (Enable sending of UL/DL messages over GSMTAP no gsmtap-sapi (Negate a command or set its defaults Disable sending of UL/DL messages over GSMTAP logging filter l1-sapi (Configure logging Filter log messages L1 SAPI no logging filter l1-sapi (Negate a command or set its defaults Configure logging Filter log messages L1 SAPI bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) value (current|max) <0-255>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change current power value Current value (for both dynamic and static modes) Maximum value (for dynamic mode only) BS power reduction (in dB) or MS power level bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) mode (static|dynamic)BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change power control mode Disable the power control loop Enable the power control loop no bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackNegate a command or set its defaults BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackBTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> rtp jitter-buffer <0-10000>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number RTP settings Jitter buffer Size of jitter buffer in (ms) no instance <0-255>Negate a command or set its defaults Select a PHY instance to remove PHY Instance number Select a PHY instance to configure PHY Instance number phy <0-255>Select a PHY to configure PHY number %s(phy-inst)# %s(phy)# no gsmtap-rlpNegate a command or set its defaults Disable generation of GSMTAP frames for RLP (non-transparent CSD) gsmtap-rlp [skip-null]Enable generation of GSMTAP frames for RLP (non-transparent CSD) Skip the generation of GSMTAP for RLP NULL frames gsmtap-sapi (enable-all|disable-all)Enable/disable sending of UL/DL messages over GSMTAP Enable all kinds of messages (all SAPI) Disable all kinds of messages (all SAPI) no gsmtap-local-hostNegate a command or set its defaults Disable local bind for GSMTAP Um logging no gsmtap-remote-hostNegate a command or set its defaults Disable GSMTAP Um logging gsmtap-local-host HOSTNAMEEnable local bind for GSMTAP Um logging (see also 'gsmtap-sapi') Local IP address or hostname gsmtap-remote-host [HOSTNAME]Enable GSMTAP Um logging (see also 'gsmtap-sapi') Remote IP address or hostname ('localhost' if omitted) show lchan summary [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel Short summary BTS Number TRX Number Timeslot Number Logical Channel Number show lchan [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel BTS Number TRX Number Timeslot Number Logical Channel Number show timeslot [<0-255>] [<0-255>] [<0-7>]Show running system information Display information about a TS BTS Number TRX Number Timeslot Number show trx [<0-255>] [<0-255>]Show running system information Display information about a TRX BTS Number TRX Number bts <0-0> c0-power-red <0-6>BTS Specific Commands BTS Number BCCH carrier power reduction operation Power reduction value (in dB, even numbers only) bts <0-0> radio-link-timeout (oml|infinite|<4-64>)BTS Specific Commands BTS Number Manually override Radio Link Timeout Use value provided by BSC via A-bis OML (Connection Failure Criterion) Use infinite timeout (DANGEROUS: only use during testing!) Number of lost SACCH blocks test send-failure-event-report <0-255>Various testing commands Send a test OML failure event report to the BSC BTS Number show bts <0-255> gprsShow running system information Display information about a BTS BTS Number GPRS/EGPRS configuration show bts [<0-255>]Show running system information Display information about a BTS BTS Number phy <0-255> instance <0-255>Configure PHY Link+Instance for this TRX PHY Link number PHY instance PHY Instance numberta-control interval <0-31>Timing Advance Control Parameters Set TA control loop interval As in P_CON_INTERVAL, in units of 2 SACCH periods (0.96 seconds) (default=0, every SACCH block) ms-power-control (dsp|osmo)Mobile Station Power Level Control Handled by DSP Handled by OsmoBTS power-ramp step-interval <1-100>Power-Ramp settings Power increase by step Step time in seconds power-ramp step-size <1-100000> (dB|mdB)Power-Ramp settings Power increase by step Step size Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) power-ramp max-initial <-10000-100000> (dBm|mdBm)Power-Ramp settings Maximum initial power Value Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) user-gain <-100000-100000> (dB|mdB)Inform BTS about additional, user-provided gain or attenuation at TRX output Value of user-provided external gain(+)/attenuation(-) Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) smscb queue-hysteresis <0-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Hysteresis of the SMSCB (CBCH) queue In count of messages/pages (default: 2) smscb queue-target-length <1-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Target length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 2) smscb queue-max-length <1-60>SMSCB (SMS Cell Broadcast) / CBCH configuration Maximum length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 15) no supp-meas-info toa256Negate a command or set its defaults Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods supp-meas-info toa256Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods pcu-socket-wqueue-length <1-2147483647>Configure the PCU socket queue length Queue length pcu-socket PATHConfigure the PCU socket file/path name UNIX socket path max-ber10k-rach <0-10000>Set the maximum BER for valid RACH requests BER in 1/10000 units (0=no BER; 100=1% BER) min-qual-norm <-100-100>Set the minimum link quality level of Normal Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) min-qual-rach <-100-100>Set the minimum link quality level of Access Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) uplink-power-filtering algo ewma beta <1-99>Configure filtering for uplink power control loop Select the filtering algorithm Exponentially Weighted Moving Average (EWMA) Smoothing factor (in %): beta = (100 - alpha) 1% - lowest smoothing, 99% - highest smoothing no uplink-power-filteringNegate a command or set its defaults Disable filtering for uplink power control loop uplink-power-target <-110-0> hysteresis <1-25>Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm Target Rx Level hysteresis Tolerable deviation in dBm Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm agch-queue-mgmt defaultAGCH queue mgmt Reset clean parameters to default values agch-queue-mgmt threshold <0-100> low <0-100> high <0-100000>AGCH queue mgmt Threshold to start cleanup in % of the maximum queue length Low water mark for cleanup in % of the maximum queue length High water mark for cleanup in % of the maximum queue length paging lifetime <0-60>Paging related parameters Maximum lifetime of a paging record Maximum lifetime of a paging record (secods) paging queue-size <1-1024>Paging related parameters Maximum length of BTS-internal paging queue Maximum length of BTS-internal paging queue (default 200) rtp hr-format (rfc5993|ts101318)RTP parameters HRv1 codec output format RFC 5993 TS 101 318 no rtp internal-uplink-ecuNegate a command or set its defaults RTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream rtp internal-uplink-ecuRTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream no rtp continuous-streamingNegate a command or set its defaults RTP parameters Always emit an RTP packet every 20 ms rtp continuous-streamingRTP parameters Always emit an RTP packet every 20 ms rtp socket-priority <0-255>RTP parameters Specify socket priority for RTP/IP packets The socket priority value (> 6 requires CAP_NET_ADMIN) rtp ip-dscp <0-63>RTP parameters Specify DSCP for RTP/IP packets The DSCP value (upper 6 bits of TOS) rtp port-range <1-65534> <1-65534>RTP parameters Range of local ports to use for RTP/RTCP traffic Port range start (inclusive) Port range end (inclusive) rtp jitter-buffer <0-10000> [adaptive]RTP parameters RTP jitter buffer Jitter buffer in ms Enable adaptive RTP jitter buffering rtp bind-ip A.B.C.DRTP parameters RTP local bind IP Address RTP local bind IP Address no oml remote-ip A.B.C.DNegate a command or set its defaults OML Parameters OML IP Address OML IP Address oml remote-ip A.B.C.DOML Parameters OML IP Address OML IP Address band (450|GSM450|480|GSM480|750|GSM750|810|GSM810|850|GSM850|900|GSM900|1800|DCS1800|1900|PCS1900)Set the frequency band of this BTS Alias for GSM450 450Mhz Alias for GSM480 480Mhz Alias for GSM750 750Mhz Alias for GSM810 810Mhz Alias for GSM850 850Mhz Alias for GSM900 900Mhz Alias for DCS1800 1800Mhz Alias for PCS1900 1900Mhz ipa unit-id <0-65534> <0-255>ip.access RSL commands Set the Unit ID of this BTS Site ID Unit ID bts BTS_NRSelect a BTS to configure BTS Number vty telnet-port <0-65535>Configure the VTY Set the VTY telnet port TCP Port number trx <0-254>Select a TRX to configure TRX number dummy-padding (on|off)Dummy padding Enable dummy padding Disable dummy padding (default) batch-size <1-65535>Batch size Batch size in bytes batch-factor <1-8>Batching factor Number of messages in the batch local-port <1-65535>Osmux port UDP port local-ip (A.B.C.D|X:X::X:X)IP information IPv4 Address to bind to IPv6 Address to bind to use (off|on|only)Configure Osmux usage Never use Osmux Use Osmux if requested by BSC (default) Always use Osmux, reject non-Osmux BSC requests osmuxConfigure Osmux no auto-bandNegate a command or set its defaults Automatically select band for ARFCN based on configured band auto-bandAutomatically select band for ARFCN based on configured band %s(osmux)# %s(trx)# %s(bts)# OsmoBTSThis command applies for newly created lchansThis command applies when the TRX powercycles or restartsBSC Send PAGING for group %u, but number of paging sub-channels is only %u paging.cDropping paging, queue full (%u) Ignoring duplicate paging struct paging_recordpaging.c:254Add paging to queue (group=%u, queue_len=%u) Dropping paging for PS, queue congested (%u) short IMSI (%zu digits), will assume "000" to calculate paging group Add MAC block to paging queue (group=%u) etws_len < 128/8Paging called for GSM wrong time: FN %d/%d/%d/%d. paging.c:738Tx PAGING TYPE 3 (4 TMSI) Tx PAGING TYPE 2 (2 TMSI,1 xMSI) Tx PAGING TYPE 1 (1 xMSI,1 empty) Tx PAGING TYPE 1 (2 xMSI) paging.c:823Removed paging record, queue_len=%u Paging SI update struct paging_statepaging.c:896num_paging != 0 after flushing all records?!? ZZ &&@@gg33MMZg &3@MBFJNbX\ %s %s Unsupported lchan->tch_mode %u measurement.c%s %s meas period end fn_mod:%d, status:%d, pchan:%s SUBFULL%s %s measurement during state: %s, num_ul_meas=%d, fn_mod=%u %s %s no space for uplink measurement, num_ul_meas=%d, fn_mod=%u %s %s adding a %s measurement (ber10k=%u, ta_offs=%d, ci_cB=%d, rssi=-%u), num_ul_meas=%d, fn_mod=%u %s Calculating measurement results for physical channel: %s %s Received %u UL measurements, expected %u %s Received %u excess UL measurements %s Replaced %u measurements with dummy values, from which %u were SUB measurements %s Received UL measurements contain %u SUB measurements, expected at least %d %s Incorrect number of SUB measurements detected! (%u vs exp >=%d) %s Received UL measurements contain %u SUB measurements, expected %d %s Incorrect number of SUB measurements detected! (%u vs exp %d) %s Computed TA256(% 4d), BER-FULL(%2u.%02u%%), RSSI-FULL(-%3udBm), C/I-FULL(% 4d cB), BER-SUB(%2u.%02u%%), RSSI-SUB(-%3udBm), C/I-SUB(% 4d cB) %s UL MEAS RXLEV_FULL(%u), RXLEV_SUB(%u), RXQUAL_FULL(%u), RXQUAL_SUB(%u), num_meas_sub(%u), num_ul_meas(%u) i < lchan->meas.num_ul_meassq_diff_sum <= UINT32_MAXinactive => activeactive => inactive%s Temporary ACCH overpower: %s %s DL-FACCH repetition: inactive => active %s DL-FACCH repetition: active => inactive % -%s AMR MR Conf: num_modes=%uamr.c, mode[%u] = %u/%u/%uAMR CMI %u not part of AMR MR set RTP->L1: overriding CMR %u AMR Multirate IE is too short (%u) AMR Multirate Version %u unknown AMR Multirate with %u modes len=%u not possible %s T3115 timeout (%d resends left) asci.c%s is not active. It is in state %s. Ignoring %s NY2 reached, sending CONNection FAILure to BSC. %s VGCS RACH on dedicated channel type %s received with TA=%u, ref=%u %s Ignoring RACH, there is an active talker already. %s Failed to deactivate uplink access after TALKER DET. %s Starting T3115 with %u ms %s Channel is activated. %s Failed to activate uplink access after channel activation. %s Channel is activated for assignment. %s Failed to deactivate uplink access for assignment. %s First valid frame detected, talker now active. %s Uplink released, no talker. %s Failed to activate uplink access after uplink became free. 0hPhp,<Xp 0h (4Dlchan.clchan_nr == 0lchan_nr < 2lchan_nr < 4lchan_nr < 8ts=%u,ss=%u Physical channel %s not expected! ts=%u,ss=%u Physical channel %s (0x%02x) not expected! (bts=%u,trx=%u,ts=%u%s,ss=%u)lchan.c:162%s Setting T200 D0=%u, D3=%u, S0=%u, S3=%u (all in frames) lchan%s SACCH no SI available %s state %s -> %s Closing RTP socket on Channel Release %s: PDCH release requested but already in switchover %s Not enough room to store interference report (%ddBm) meas_num > 0%s Interference AVG: %ddBm (band %d, samples %u) %s Rx RSL IPAC CRCX, but we already have socket! %s IPAC Failed to create RTP/RTCP sockets %s IPAC Failed to create RTP/RTCP sockets%s IPAC Failed to set RTP socket parameters: %s %s IPAC set RTP socket parameters: %d failed to set DSCP=%d: %s failed to set socket priority %d: %s %s IPAC Failed to bind RTP/RTCP sockets %s IPAC Failed to bind RTP/RTCP socketsbts@%sOsmoBTS-1.10.0.30-b2d3%s Failed to connect RTP/RTCP sockets %s IPAC cannot obtain locally bound IP/port: %d %s freeing %d queued frames non-transparenttransparent @ 1200/75 bpstransparent @ 600 bpstransparent @ 1200 bpstransparent @ 2400 bpstransparent @ 4800 bpstransparent @ 9600 bpstransparent @ 14400 bpstransparent @ 29000 bpstransparent @ 32000 bpsRX_REQRX_CONFRXTX_REQRX_CONF_TX_REQRXTX_CONFACTIVATION REQUESTEDACTIVERELEASE REQUESTEDRELEASE DUE ERRORBROKEN UNUSABLE(00T000l t  %s not (yet) provisioned pcu_sock.cA transceiver with ARFCN %u is not (yet) provisioned PCU socket has LOST connection PCU socket has LOST connectionPCUIF connection closed pcu_sock.c:1193pcu_sock_txPCU socket not created, dropping message PCU socket not connected, dropping message Sending info BTS is up BTS is down %s PCU interface (version %u) cannot handle more than %zu transceivers => skipped %s unavailable for PCU (op=%s adm=%s) %s PDCH on ts=%u is available (tsc=%u hopping=yes hsn=%u maio=%u ma_bit_len=%u) hopping=no arfcn=%u) PCU connects but we already have another active connection ?!? PCU socket connected to external PCU Sending rts request: is_ptcch=%d arfcn=%d block=%d Sending data indication: sapi=%s arfcn=%d block=%d data=%s Updating SI%s to PCU: %s Revoking SI%s from PCU Failed to send SI%s to PCU: rc=%d OsmoPCU version %s connected SI%s is not available on PCU connection Unknown TXT_IND type %u received ActivateDeactivateReceived %d bytes on PCU Socket, but primitive hdr size is %zu, discarding Received %zu bytes on PCU Socket, but primitive %s size is %zu, discarding pcu_prim->u.data_reqReceived PCU Prim for non-existent BTS %u Data request received: sapi=%s arfcn=%d block=%d data=%s Rx malformed DATA.req for PCH pcu_agchReceived PCU data request with not existing TRX %d Received PCU data request with not existing TS %u %s: Received PCU DATA request for non-PDCH TS %s: Received PCU DATA request for inactive lchan Received PCU data request with unsupported sapi %d pcu_prim->u.pag_reqPaging request received: chan_needed=%d length=%d (dropping message because support for PCU_IF_MSG_PAG_REQ is not yet implemented) pcu_prim->u.act_req%s request received: TRX=%d TS=%d %s request, but lchan is not of type PDTCH (is %s) %s request, but lchan in dyn TS is not configured as PDCH in lower layers (is %s) pcu_prim->u.txt_indpcu_prim->u.containerReceived %zu bytes on PCU Socket, but primitive container size is %zu, discarding Received unknown PCU msg type %d Sending RACH indication: qta=%d, ra=%d, fn=%d Paging identity too large (%d) PCU socket not created, ignoring paging message Sending DATA.cnf: sapi=%s msg_id=%08x struct pcu_sock_statestate->srv_linkPCUIFCould not create %s unix socket: %s Started listening on PCU socket (PCU IF v%u): %s PCH_2AGCH_2PHYS INFO%s Sending PHYSICAL INFORMATION to MS. handover.c%s T3105 timeout (%d resends left) %s is in not active. It is in state %s. Ignoring %s NY1 reached, sending CONNection FAILure to BSC. %s RACH on dedicated channel received, but ra=0x%02x != expected ref=0x%02x. (This is no bug) %s handover RACH received on %s?! %s RACH on dedicated channel type %s received with TA=%u, ref=%u %s failed to modify channel after handover %s Starting T3105 with %u ms %s First valid frame detected BDFH468:456789:;Incorrect OM hdr length value %d %zu msg_utils.cFOM header insufficient space %zu %zu %s failed to decode AMR RTP (length %zu, %p) %s unsupported AMR FT 0x%02x %s Have to send %s frame on TCH but SID buffer is empty - sent nothing Ipa header insufficient space %d %zu Incorrect ipa header msg size %d %zu IPA length shorter than OSMO header Om header insufficient space %d %zu Incorrect om mdisc value %x Incorrect om placement value %x %x Incorrect om sequence value %d No ManId Length Indicator %zu Insufficient message space for this ManId Length %d %zu Manuf Label Unknown %s ramp_timer_cb(cur_pout=%d, tgt_pout=%d, ramp_att=%d, therm_att=%d, user_gain=%d) tx_power.c%s ramping TRX board output power to %d mdBm. %s bts_model notifies us of %d mdBm TRX output power. However, it should be %d mdBm! , bypass%s power_ramp_start(cur=%d, tgt=%d%s) %s Asked to ramp power up to %d mdBm, which exceeds P_max_out (%d) %s target_power (%d mdBm) is below or equal to 'power ramp max-initial' power (%d mdBm) 8%s{%s}: Timer expired waiting for ramp down complete bts_shutdown_fsm.c%s{%s}: Timer expired waiting for TRX close %s{%s}: %s TRX closed, %u TRX remaining %s{%s}: %s Ramping down complete, %u TRX remaining %s{%s}: No TRX is operational, skipping power ramp down %s{%s}: Shutdown process completed successfully, exiting process osmo_fsm_register(&bts_shutdown_fsm) == 0%s{%s}: BTS is already being shutdown. %s{%s}: Shutting down BTS, exit %u, reason: %s fi=NULL%s{%s}: %s Received TRX close cb rc=%d BTS_SHUTDOWNBTS_SHUTDOWN_EV_STARTBTS_SHUTDOWN_EV_TRX_RAMP_COMPLBTS_SHUTDOWN_EV_TRX_CLOSEDWAIT_RAMP_DOWN_COMPLWAIT_TRX_CLOSEDEXIT++++++++++++++++++++!+++++++++++++++++(P@(P@l1sap_rtp_rx_cb`h 00th80H0//P0 \0 l0 d0 0 T0|0t000(000 000@0%s RTP clock out of sync with lower layer: %u vs %d (%u->%u) l1sap.c%s Ignoring an Access Burst on %s: BER10k(%u) > BER10k_MAX(%u) %s Ignoring an Access Burst on %s: ToA(%d) exceeds the allowed range (%d..%d) %s Ignoring an Access Burst on %s: link quality (%d) below the minimum (%d) %s radio link timeout counter S is already 0 %s decreasing radio link timeout counter S=%d -> %d %s radio link timeout counter S reached zero, dropping connection %s increasing radio link timeout counter S=%d -> %d rc >= 0GSMTAPMPH INFOTCHDATA%s %s %s meas ind, ta_offs_256bits=%d, ber10k=%d, inv_rssi=%u, C/I=%d cB %s %s Skipping RTP frame with lost payload %s assuming active lchan, but state is %s %s Rx PH-DATA.ind chan_nr=%s link_id=0x%02x len=%d %s No lchan for chan_nr=%s %s There can be no DATA.ind on PTCCH/U. This is probably a bug of the BTS model you're using, please fix! %s UL-SACCH repetition: inactive => active %s UL-SACCH repetition: active => inactive %s %s Lost SACCH block l1sap_prim%s No lchan for PH-RTS.ind (chan_nr=%s) %s %s Rx TCH-RTS.ind bits_per_20ms != 0%s %s Tx TCH.req %s %s DL TCH Tx queue underrun msgb_l2len(msg) == 240%s %s Invalid TCH mode in TCH-RTS.ind under CSD NT PH-RTS-IND%s BTS model is sending us PRIM_INFO_TIME for TRX %u, please fix it %s Rx MPH_INFO time ind %s Invalid condition detected: Frame difference is %u-%u=%u > 1! unknown MPH_INFO ind type %d %s get_lchan_by_chan_nr(chan_nr=%s) yields NULL for PRIM_INFO_ACTIVATE.conf %s activate confirm chan_nr=%s trx=%d %s deactivate confirm chan_nr=%s trx=%d unknown MPH_INFO cnf type %d %s Rx PH-RTS.ind chan_nr=%s link_id=0x%02xd %s RTS without msg to be reused. Please fix! %s %s no looped PDTCH message, sending empty %s %s looped PDTCH message of %u bytes %s %s Forward RLL RELease INDication to the BSC %s DL-SACCH repetition: inactive => active %s DL-SACCH repetition: active => inactive rep_sacchrep_facch_0rep_facch_1%s Tx PH-DATA.req chan_nr=%s link_id=0x%02x %s No lchan for TCH.ind (chan_nr=%s) %s %s Rx TCH.ind msg->len == GSM_HR_BYTES%s Rx PH-RA.ind %s Access Burst for continuous Timing Advance control (toa256=%d) %s Access Bursts on PDTCH/U are not (yet) supported %s Attempting to set invalid Timing Offset value %d (MS TO = %u)! %s RACH for packet access (toa=%d, ra=%d) %s RACH for RR access (toa=%d, ra=%d) unknown prim %d op %d%s Rx -> RTP: %s TX packet data %s is_ptcch=%d trx=%d ts=%d block_nr=%d, arfcn=%d, len=%d %s %s(): incoming RTP truncated: %u -> %u -shadow%s Trying to activate already active channel %s %s Activating channel %s bts%u-trx%u-ts%u-ss%u%s%s Trying to deactivate already deactivated channel %s %s Deactivating channel %s %s Deactivating SACCH on channel %s %s Modifying channel %s ActivatingDeactivating%s Channel %s is not an active ASCI type channel. %s %s uplink access detection on channel %s 4&<&H&P&select_next_smscbcbch.c:327cbch.c:333cbch.c:335cbch.cCBCH-EXTENDEDCBCH-BASIC%s %s: No cur_msg; requesting NULL block %s %s: cur_msg has only %u blocks; requesting NULL block to_copy >= 0%s %s: deleting fully-transmitted message %p cbch.c:148%s %s: keeping fully-transmitted default message %p %s: Cannot process SMSCB of %u bytes (max %zu) struct smscb_msgRSL SMSCB COMMAND (chan=%s, type=%s, num_blocks=%u) RSL SMSCB COMMAND (chan=%s, type=%s): OVERFLOW cbch.c:223cbch.c:235cbch.c:242cbch.c:246%s: %s: Dequeued msg %s: %s: Using default msg %s: %s: No queued msg nor default NORMALSCHEDULEDEFAULTNULL &2    RaisingLoweringpower_control.c%s Failed to calculate dBm for power ctl level %u on band %s %s Failed to retrieve power level for %d dBm on band %d %s Keeping MS power at control level %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s %s MS power control level %d (%d dBm) => %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s Rx DL Measurement Report: RXLEV-FULL(%02u), RXQUAL-FULL(%u), RXLEV-SUB(%02u), RXQUAL-SUB(%u), DTx is %s => using %s %s Keeping DL attenuation at %u dB: max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] %s %s DL attenuation %u dB => %u dB:max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] 2h2d2D2c2s2T2V2e3i3t3r(3. 83. D3. signal %u received BTS: SIGINT received -> shutdownSIGINTOsmoBTS contextsum-hc:d:Dc:sTVe:i:t:r:Some useful options: -h --help this text -d --debug MASK Enable debugging (e.g. -d DRSL:DOML:DLAPDM) -D --daemonize For the process into a background daemon -c --config-file Specify the filename of the config file -s --disable-color Don't use colors in stderr log output -T --timestamp Prefix every log line with a timestamp -V --version Print version information and exit -e --log-level Set a global log-level VTY reference generation: --vty-ref-mode MODE VTY reference generation mode (e.g. 'expert'). --vty-ref-xml Generate the VTY reference XML output and exit. Regression testing: --vty-test VTY test mode. Do not connect to BSC, do not exit.%s: Unknown VTY reference generation mode '%s' Generating the VTY reference in mode '%s' (%s) %s: error parsing cmdline options Command line argument '-r' is deprecated, use VTY cpu-sched node setting 'policy rr %d' instead. Command line argument '-i' is deprecated, use VTY parameter 'gsmtap-remote-host %s' instead. Command line argument '-t' is deprecated and does nothing, TRX number is calculated from the VTY automatically. ((*)) | / \ OsmoBTS --- VTY test mode: not connecting to BSC, not exiting --- Failed to create BTS Site Manager structure Failed to create BTS structure Setting SCHED_RR priority(%d) failed: %s unable to open bts Failed to parse the config file: '%s' You need to configure at least phy0 TRX %u has no associated PHY instance Command line argument '-i %s' overrides 'gsmtap-remote-host %s' from the config file main.c:356Setting up GSMTAP Um forwarding '%s'->'%s:%u' Failed during gsmtap_source_init2() Error initializing telnet PCU L1 socket failed Osmux setup failed osmo-btsunable to open PHY link(s) Error during daemonizehelpdebugdaemonizeconfig-filedisable-colortimestampversionlog-levelgsmtap-iptrx-numrealtimevty-ref-modevty-ref-xmlvty-testosmo-bts.cfgd+44struct phy_linkphy%u%s: PHY link state change %s -> %s phy_link.cstruct phy_instancepinst->trx == NULLpinst->trx->pinst == pinstphy_link.c:139phy_link.c:149phy%u.%u%s: This PHY instance is not associated with a TRX instance, check the configuration file! connecting<5D5L5T5`5p5x55dtx_dl_amr_fsm.cUnexpected event %d Inexpected event %d DTX_DL_AMR_FSMVoiceONSETFACCHCompleteFIRST P1->P2InhibitSID-FIRSTSID-UPDATESID-FIRST (P1)SID-FIRST (P2)SID-FIRST (Inh, SPEECH)SID-FIRST (Inh, FACCH)SID-UPDATE (Inh, SPEECH)SID-UPDATE (Inh, FACCH)SID-UPDATE (NoInh)SID-FIRST (Inh, SPEECH, Rec)SID-FIRST (Inh, FACCH, Rec)SID-UPDATE (Inh, SPEECH, Rec)SID-UPDATE (Inh, FACCH, Rec)SID-UPDATE (AMR/HR)ONSET (SPEECH)ONSET (FACCH)ONSET (SPEECH, Rec)ONSET (FACCH, Rec)0h30`fПl fpf fh0ЩhЩh0yЩhrЩh0lЩ heЩ@h0_ЩhXЩh0Rܩ hKܩ0h0Eܩh>ܩh08e                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                $$$$%%%%&&&&    """"    """"####$$$$%%%%&&&&####$$$$%%%%&&&&    !!!!""""    !!!!""""####$$$$%%%%&&&&####                                                               BCCH+CCCHBCCH+CCCH+SDCCH/4+SACCH/4BCCH+CCCH+SDCCH/4+SACCH/4+CBCHSDCCH/8+SACCH/8SDCCH/8+SACCH/8+CBCHTCH/F+SACCHTCH/H+SACCHlateearly%s Keeping current TA at %u: TOA was %d ta_control.c%s %s TA %u => %u: TOA was too %s (%d) nm_bts_sm_fsm.cosmo_fsm_register(&nm_bts_sm_fsm) == 0NM_BTS_SM_OPDISABLED_NOTINSTALLEDDISABLED_OFFLINEENABLEDnm_bts_fsm.cnm_bts_fsm.c:66osmo_fsm_register(&nm_bts_fsm) == 0NM_BTS_OPnm_bb_transc_fsm.c rsl phy opstart%s{%s}: Not connecting RSL in OML-DUMMY! %s{%s}: Error connecting IPA RSL: %d %s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s nm_bb_transc_fsm.c:63osmo_fsm_register(&nm_bb_transc_fsm) == 0NM_BBTRANSC_OPnm_channel_fsm.c%s{%s}: BSC trying to activate TS while still in avail=dependency. Allowing it to stay backward-compatible with older osmo-bts versions, but BSC is wrong. nm_channel_fsm.c:62osmo_fsm_register(&nm_chan_fsm) == 0NM_CHAN_OPDISABLED_DEPENDENCYnm_gprs_cell_fsm.cosmo_fsm_register(&nm_gprs_cell_fsm) == 0NM_GPRS_CELL_OPnm_gprs_nse_fsm.cosmo_fsm_register(&nm_gprs_nse_fsm) == 0NM_GPRS_NSE_OPnm_gprs_nsvc_fsm.cosmo_fsm_register(&nm_gprs_nsvc_fsm) == 0NM_GPRS_NSVC_OPnm_radio_carrier_fsm.c setattr%s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s%s nm_radio_carrier_fsm.c:52osmo_fsm_register(&nm_rcarrier_fsm) == 0NM_RCARRIER_OPstruct asci_notificationAdded ASCI Notification for group call reference %s notification.cDeleting ASCI Notification for group call reference %s notification.c:91Deleting all %u ASCI Notifications of BTS notification.c:109gcr_bvchd_bv DRSLA-bis Radio Siganlling Link (RSL)DOMLA-bis Network Management / O&M (NM/OML)DRLLA-bis Radio Link Layer (RLL)DRRLayer3 Radio Resource (RR)DMEASRadio Measurement ProcessingDPAGPaging SubsystemDL1CLayer 1 Control (MPH)DL1PLayer 1 Primitives (PH)DDSPDSP Trace MessagesDPCUPCU interfaceDHOHandoverDTRXTRX interfaceDLOOPControl loopsDABISA-bis Intput SubsystemDRTPRealtime Transfer ProtocolDOSMUXOsmux (Osmocom RTP multiplexing)DASCIASCI (Advanced Speech Call Items: VGCS/VBS)$4OML link was closed early within %llu seconds. If this situation persists, please check your BTS and BSC configuration files for errors. A common error is a mismatch between unit_id configuration parameters of BTS and BSC. abis.cevent == ABIS_LINK_EV_SIGN_LINK_DOWNE1L(%u) Signalling link down OML Signalling link up RSL Signalling link for TRX%d up TRX%d does not exist! Input Signal %s received for ts-%u-%u link_type=%s %s{%s}: List of BSCs to connect to is empty! priv->current_bsc%s{%s}: BTS is shutting down, delaying A-bis connection establishment to BSC %s{%s}: No BSC available, A-bis connection establishment failed A-bis connection establishment to BSC (%s) in progress... eth0ipaevent == ABIS_LINK_EV_VTY_RM_ADDRDrop Tx OML msg, OML link is down msg->trxCannot determine remote IP Addr: %s sin.sin_family == AF_INETNo BSC configured, cannot start BTS without knowing BSC OML IP abis_linkbts->abis_link_fistruct abis_link_fsm_privabis_link_fsm_privosmo_fsm_register(&abis_link_fsm) == 0WAIT_RECONNECTCONNECTINGCONNECTEDFAILEDSIGN_LINK_OML_UPSIGN_LINK_DOWNVTY_RM_ADDRIPA/ABIS/OSMOABIS_OSMO_PCU message too short abis_osmo.cRx BSC->BTS%d ABIS_OSMO_PCU msg type %u OSMO message unknown extension %u Releasing unused osmux handle for %s osmux.cosmux.c:155osmux.c:156Cannot find Osmux input handle %p osmux sendto(%s) failed: %s OSMUXcannot allocate message cannot receive message Cannot find lchan for %s CID=%d %s received RTP frame too short (len = %d) Osmux CID %u is back to the pool 127.0.0.1*Failed binding Osmux socket to %s:%u Osmux socket listening on %s:%u All Osmux circuits are in use! Allocating Osmux CID %u from pool lchan->abis_ip.osmux.useosmux.c:448lchan->abis_ip.connect_ip != 0lchan->abis_ip.connect_port != 0Using existing OSMUX handle for rem_addr=%s osmux.c:179Created new OSMUX handle for rem_addr=%s %s Cannot allocate input osmux handle %s Cannot open osmux circuit %u struct osmux_handle%s RTP->L1: Dropping unexpected AMR encoding (bw-efficient?) %s rtp_input_preen.ccsd_rlp.cdata_len == 120data_len == 290<<$$csd_v110.clchan->tch_mode < ARRAY_SIZE(csd_v110_lchan_desc)data_len == CSD_V110_NUM_BITS(desc)    ( 0DXlSW_ACTRX_SETATTRRX_OPSTARTOPSTART_ACKOPSTART_NACKSHUTDOWN_STARTSHUTDOWN_FINISHOML_UPRSL_UPRSL_DOWNPHYLINK_UPPHYLINK_DOWNDISABLEBBTRANSC_ENABLEDBBTRANSC_DISABLEDRCARRIER_ENABLEDRCARRIER_DISABLEDWrite Only attributeValue is out of rangeOK%uOOMset_therm_att(trx=%p, tpp=%p) max-ber10k-rachoml-alertthermal-attenuationȣjggh~ JMLo4 7E[xyS% 6 ,  p   g   f  $ ( , en0 1t4 ,8 ( ,<  @ ,\D VjF zG H  !P )SX *S\ +S` ,Sd .3h /,l ]1p  n n t ,=  6  'b ;<~=ttt%,  } $,|  66M,aaagO "tQ $t2 # 1,% 6,' :,   9 ,  ; ,  , *> /&,;a 6G  ;>  i - M   o MtT@7_Hv? 1 !_"#.$n%&g ' ()* +,- .Y / 01D23 4567889:; <v =. >% ?%@bA Be CDEF;G HJ IJcKLMNOnPQRSETUVWXYZw [\ ]^_` aE bS cUd e fg0h % x H   -p >\w> @ >#. p H Y O ` | +  9  E0 G P, Q,9  R T W,8 Y Ac> M!  > TKd E \  ^  _rev `,  a!  bK  c n, > i 3?KUWcg  o2? L{ K   n  ,@ , , ,  ,` ,5 ,@ ,j , , ,t ,s ,* ,V , , ,! , , , ,y , , , , ,. , , ,    P  > 4   }     >= ,\ uUX {> %vn  c  X   s (n ns ds (rpn qs Prs ys lz1h lz2h ,ih ?kh s h %dpintO<,~ \\b w % w w}S (Q T*Q ,Q .Q "0 1 _T ?C`}5C%OCwCw:V7 8siW,@ PwQxRy }II7[(../sysdeps/arm/crtn.S/usr/src/debug/glibc/2.25-r0/git/csuGNU AS 2.28.0%% $ > $ > &I4: ; I?U%%%%%%%%%%%%%% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8 .?: ;'I@B: ;I: ;I4: ;I 4: ;I% $ > : ; I&I$ > I! I ' I 4: ; I?< ' .?: ; '@B.?: ; '@B: ; I4: ; I 4: ; IB1.?<n: ; U%U- ../sysdeps/armstart.Si/1/11.11/22q.4/HB /usr/src/debug/glibc/2.25-r0/git/csuinit.ch, ../sysdeps/armcrti.Sj?/0////W0X l ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.S 0/////0/1//0L/2f///////l ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.S  /00///0////00/00/10//0L/0/2///////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-df.S/365//00////2/0////////301////3/1///3/3/ .1///////////0//2/5//3///1///1//50////2/////.0//0/3///2////20/5/20//2////1/////2/////2//3/0///20/00/10//02//1///0//0//2/// .0//0//0/// .0/04//2/ .0/04//02/ .///0///00/14/// .004/ .004/3/1/ ./1/0/0/0//////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-df.S6//0///112//0///.//////401//////1////10/10///2////0//1//110//1////1/////////0/2////////0/2////////0/3/////0///0////0///2/0/10/2///10//////////0//22////2// .6//0///112//////////120/////1/////1/0//////0//////0//////0//0/////////2/////10/10/10////2//0//0///3/2/0/////////////////00/0////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-df.S8 ///////1////0/0///0/!m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S:/3 .0////2/0///0301//0///02/22//1/3/3///1//1/5/0//2////.///5//403/0///100/0/10/02/1//0//0//2// .0///0/// ./3000110/ .00/300/3/10//10/./2/0////0/0////0/Dm ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S/0///2130////.130//11//1/0/2/0///0//1//210/1///////0/3/0//////0/////2/0/10/2//10///////////0/22///2// ./0///212/////120/1/0//0//0//0//0/1/1/0/2//0//0///3/0//////0/////2//////////////00/0////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S/2/305//0/ .100200/6///////00.///5602/ .20//620//620//620//620/0m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S/////1///0/0/0////0/0/m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S,//////1///0/0/////0/h ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armbpabi.SL/gl ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.S  .//z ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc-native/usr/lib/arm-poky-linux-gnueabi/gcc/arm-poky-linux-gnueabi/6.4.0/include/usr/include/bits/usr/include../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../include/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/gcc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.h t. .t.g J0/hJJ1I/I2LEiLOe/-0K2K0 /usr/src/debug/glibc/2.25-r0/git/csu/usr/src/debug/glibc/2.25-r0/recipe-sysroot-native/usr/lib/arm-poky-linux-gnueabi.gcc-cross-initial-arm/gcc/arm-poky-linux-gnueabi/6.4.0/includeelf-init.cstddef.h.nf2f/ P, ../sysdeps/armcrtn.SW/\ 7 |  |   | @ H T @$ H J @( H L @@ X H $@Tt F D F j | l B4 4 B | <8T j | `  `(( T `P F |   t`  | t LJ BN RB H$ JH l BH  BH  BH  BH  BH | \ n | ,T j | <TH |  D | H(D | |`B  |T long long intlong long unsigned int/usr/src/debug/glibc/2.25-r0/git/csuunsigned char/usr/src/debug/glibc/2.25-r0/git/csu/init.cGNU C11 6.4.0 -march=armv5te -marm -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -ftls-model=initial-execshort unsigned int_IO_stdin_usedshort intsizetypearm710tarm_arch_iwmmxt_shortbufARM_EQ_IO_lock_tarm600program_invocation_short_namestderrarm2_IO_buf_end__udivmoddi4arm6arm_fp_modelARM_PCS_AAPCS_IWMMXToptoptarm9BASE_ARCH_0BASE_ARCH_2BASE_ARCH_3BASE_ARCH_4BASE_ARCH_5BASE_ARCH_6BASE_ARCH_7cortexa15cortexa7fa606te_IO_write_endvfp_reg_typefmp626GNU C11 6.4.0 -march=armv5te -marm -mtls-dialect=gnu -g -g -g -O2 -O2 -O2 -feliminate-unused-debug-types -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hiddengetdate_errUSItype_flagsarm610arm10earm9ecortexa72cortexa53arm_ccfsm_statearm1022efa626unspec_stringscortexm0plussmallmultiply__clz_tabARM_VCarm_arch_xscalearm7tdmiscortexm0plusARM_VSARM_GEarm_tune_strongarmarm7complex floatARM_GTarm620regscortexa5cortexa8cortexa9__timezoneBASE_ARCH_7EMhashval_tBASE_ARCH_6KZarm740tarm_arch_arm_hwdiv_posarm_fpu_descstdoutall_fpus_IO_save_endopterr_cur_columnfa626tearm7dmistrongarm110BASE_ARCH_3Mmpcorenovfparm9tdmiarm_cond_codeARM_PCS_AAPCS_IO_backup_baseARM_PCS_AAPCS_LOCALarm_fpu_feature_setcortexr4cortexr5cortexr7cortexr8arm_arch_iwmmxt2VFP_NONE_fileno__pad2arm1156t2fs_sys_nerrprefer_neon_for_64bitscortexr4fsize_t_vtable_offset_markerscortexa12unspecv_stringscortexa15cortexa17_IO_read_basearm_arch3marm940tstdinarm920BASE_ARCH_4T_nextarm_regs_in_sequencereturn_used_this_functionBASE_ARCH_5TE_IO_markerarm1176jzfs_chainarm_lang_output_object_attributes_hookarm720tBASE_ARCH_5Earm7500fe_IO_2_1_stderr_processor_typearm_pcs_modearm_arch4tstrongarm1100arm700arm_tune_wbufhtab_hash_IO_read_ptrarm_arch_namecortexa32cortexa35arm_arch_notmarm_arch5eARM_LEBASE_ARCH_6JBASE_ARCH_6KBASE_ARCH_6MARM_LSARM_LT_IO_write_basestrongarm1110BASE_ARCH_6Zarm926ejsarm710_IO_2_1_stdin_arm_fpu_attr_IO_2_1_stdout__IO_save_basehtab_hash_pointerBASE_ARCH_5Tarm7500arm968esBASE_ARCH_7AARM_FP_MODEL_UNKNOWNARM_MIarm_arch6karm_arch6mBASE_ARCH_7R__popcount_tabarm920tarm720arm1136jshtab_eq__pad1arm946es__pad3__pad4__pad5ARM_PCS_AAPCS_VFParm_arch_no_volatile_cecortexa57BASE_ARCH_8Aarm700iARM_NEarm60featuresoptindARM_HIprogram_invocation_nameoptargARM_NVarm_arch4cortexm0smallmultiplyarm_arch6arm_arch7arm_arch8long doublecortexa57cortexa53/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/libgccarm_tune_xscalearm_arch5cortexa17cortexa7arm7di__quad_tmaking_const_tablethumb_call_via_labelarm1156t2s_IO_read_endARM_PCS_APCSARM_PCS_ATPCScomplex doublearm922tarm_cc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/libgcc2.cmpcorebase_architecturearm_arch_crcarm1176jzsarm_current_ccfa526cortexa72__environarm966es_IO_FILE_plusARM_PLmarvell_pj4BASE_ARCH_6T2BASE_ARCH_5TEJarm_tune_cortex_a9ARM_ALBASE_ARCH_7Marm_target_labelarm_target_insnarm250_lockxgene1pool_vector_labelarm1026ejs_old_offset_IO_FILEarm1136jfs_dont_use_rtx_here_arm70exynosm1UQItypeVFP_REG_D16arm_tunearm_cpp_interworkarm7d__tzname_sbufcortexm1smallmultiplyarm_arch_thumb_hwdiv_IO_write_ptrarm10tdmiARM_FP_MODEL_VFPhtab_eq_pointerarm7marm_pic_registerfa726teARM_CCarm_ld_schedarm810ARM_CSVFP_REG_SINGLEarm7dm__off_tgenericv7aarm_base_arch_sys_errlistarm_arch7emarm7100arm_pcs_defaultVFP_REG_D32ARM_PCS_UNKNOWNep9312arm3arm_arch_thumb2cortexm0cortexm1arm8cortexm3cortexm4arm7tdmicortexm7UDItype_flags2arm_none__daylightarm1020earm710cqdf24xx_unused2_IO_buf_basearm_arch8_1arm1020t__off64_t__init_array_startenvp/usr/src/debug/glibc/2.25-r0/git/csu/elf-init.c__libc_csu_fini__fini_array_end__init_array_end__preinit_array_start__fini_array_startargcsize__libc_csu_initargv__preinit_array_endGNU C11 6.4.0 -march=armv5te -marm -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -fPIC -ftls-model=initial-execPQ(%RS(% PQRS(PQTUTUTUTU(TU`RS`VWRSDpQ\VvVvVH\'P'`W'Q'`X'R'`Y(,v2&,`V(4048T8LtL`Tj4jWWX \ WW\ ` Th+0H$K4L 4M W W lg X `  48< H 0!  !"#hmi j ^3` H pmj j ,j mW mX mW m\  mP_ P_x +_ ` mlg Alg$ g m` X` T  m  V   m ^<  mg og8 g m  m @   D `m̢ ̢ Т     1$p  m F ( m4 Y4 P m`  m p|  mg g8 g   H\m   $ 1̥| D mH YH  h mx H mT T ا mܧ pܧ  m  P mh h8 ,h  T Hتm\ \ d mt tt  m  t mx Yx  mЫ @ mt tL  m p< ذ m   m d T m0080h#0m  &00ml  m  d m|  m < m@ \ ml  m ?0m I0\ \0  m0m<  m  8y0m 0  m 0  m 0 H mt 0t`  m 0 l m  m,  m \ mx  m   m  m0 . 0. 0. з1m  /1m A1L D mH  V1m  m$ 8T`1m` l m t k1v11m 1  m 1 1,  m 1<  m  1 @ @  mH  1H H  m  2 (  m  2 @  m  %2 | l  mt   32 A2 O2! / / c2m  n2  2 2m  2  20 2m P 2m 2m8 L 2m p 2m  3m  3m  3m,  23m  D30 m P3m X Z3m L  mT   re38s383 3433mW W mW 33QH 3l$ 4 4< #4K4$d [4xD i4EE4 4(4l 444t 55R, ,5$ A5d``T5@$j5<55555P 5 $ 6T !6D6C P6m68 y6| 860| 6`  6667`"0178F7ؔ V7\TD k7xl 77l, 7778,T #8:8L8k8| }88d 8T  8h 8< 8 8l 8/ 805  9D *9{d ?9Te S9< i99V 9L 9$ 999\  :: Qi 0:X:Y g: 8u:t ::k :::;tn 7;  A;\ U;z;p] ;, ;;@ ; ;;p8, <h <3<t` @<Tt N<x& [<6 q<<<H <<<<=2=Q A= P=j _=~==` ===>*>O>\ a> j>`| v>> >t$ > >. >,T >X ~  ?`  ?D  .?( :?lD4 G?l?p ~??t ?? T ??l @"@Dt 4@  A@N@`@@@@ @X 8X @< @d @p A'AL 8AZAx?` lAA 8AA" AAB(BKBd ]B\BX&BDk B  B@P Bl B\CP( 'Cl ECeCC| CuT CCH$ CCD$=D[D&huDD,2 DDP D- DD" EE4EX DEUEp ^E  qE 8}EEEE~4 EHP E FGFm  \FsF FFFF  GLG< G4H 4GFGxn  jGGGGG H2HD FH0ehWHX jHhHij H H HHL\$ I 'IX#/I0! (CIkIlv` |Il I, I4 ISH III0T J( Jm\ $J\k\| \\x0 \( \\,` \   \`! ]2]P]d X]t o]l8 ]L ]]h` ]h ]]d ^@ ^4^  E^v^^q ^^^ ` _(_ 7_!4 I_/ Q_h `_ i_` y_0 _ _/ f_