ELF(p4l4 ('&plll444  TTTxxDWHe  hhhhhDDQtdRtd44/lib/ld-linux.so.3GNUGNU|3 i>1ix&X  @,B4@ L5`TЊ$@ 2M` K\ T`@(Ex,PB,) @PFHR ((& "8@@@ (   @"XB@ AA !H \J` @ AE)Q @A% m T@@( CEHCE$ A  p&%`cB(%aB AJrA@(AHP   !"#$&'()*+,-./0123456789:;<=>?@ACDFGHIKLMOPQTVWXYZ\]^_`abdefgijklopqstuvwz{|}~    !"#$&()+,-./0123457:;=>?@ABCDEFGHIJMNORTVWXYZ[]^_`abefghijklmnopqrstuvwyz{|}NxDD'GB% 6AM|AkF멦΁gcUHWkK}dUqV p'␕{% WʸW+l] 4&yMJëGqqX}ZCY%kv: OIB}Ml|q{|i=!TÎ,m&Y7|#P82<[#%owT<L EOֺ?~|ĖsVjCA1Ar3u:? O'[;\v "RwɑFyܾ]?kƛ_%#+ƣd/ Dnˡ2u9ځhì9vN[q;BN3q/[4y!SBf~ ^%u LFww%(cZI㸏v!.LuKq#/mgr ޤ TkP7ೕx|Qi[_k^-ϱ2,|ɬe.7; R  f _v jx] 5B[   z ju RN zx<t %< | sB  uPQ }PB (gu(?6PP =LB - X  #0C;h+LB ,; kR U  P B =vWot  +v  ? a< \|j ;4 hp}d Y^< HB ( >-?S,ixB  W TF MZL/ p G AS ){ \]  $ el pB B y  i{tLB <h 2a &" R <eF],UPP  5c  F : <SGJ$&  1aDoLK  ?x T].PP 5IDT PC T`2|H  B  B  zZ 3Z) \ >9 t   ( )+PiggPP LB  libosmoctrl.so.0_ITM_deregisterTMCloneTableinstall_node__gmon_start__vty_out_Jv_RegisterClasses_ITM_registerTMCloneTablectrl_interface_setupctrl_parse_get_numctrl_cmd_def_makectrl_cmd_installctrl_vty_initctrl_cmd_def_sendctrl_cmd_def_is_zombielibosmoabis.so.15osmo_stream_srv_create2osmo_stream_srv_link_destroyosmo_stream_srv_set_read_cbosmo_stream_srv_link_openosmo_stream_srv_get_dataosmo_stream_srv_link_set_datavty_out_rate_ctr_grouposmo_stream_srv_link_set_addrosmo_stream_srv_link_set_nameosmo_stream_srv_link_set_accept_cbosmo_stream_srv_sendosmo_stream_srv_link_createosmo_stream_srv_link_get_dataosmo_stream_srv_destroyosmo_stream_srv_set_closed_cbe1inp_ipa_bts_rsl_close_ne1inp_line_bind_opse1inp_line_updatee1inp_signal_nameslibosmo_abis_inite1inp_line_createe1inp_signtype_namee1inp_ts_config_signe1inp_sign_link_destroye1inp_ipa_bts_rsl_connect_ne1inp_line_find_finiabis_sendmsge1inp_vty_inite1inp_sign_link_createlibosmotrau.so.11osmo_fr_check_sidosmo_hr_check_sidosmo_efr_check_sidosmo_hr_sid_resetosmo_fr_sid_classifyosmo_efr_sid_classifyosmo_rtp_socket_createosmo_csd_ra2_16k_packosmo_csd144_to_atrau_bitsosmo_rtp_send_frame_extosmo_rtp_socket_set_ptosmo_rtp_skipped_frameosmo_rtp_socket_statsosmo_csd_ra2_16k_unpackosmo_rtp_socket_pollosmo_rtp_socket_set_dscposmo_rtp_socket_freeosmo_csd_ra2_8k_packosmo_rtp_socket_set_priorityosmo_rtp_socket_log_statsosmo_rtp_socket_set_paramosmo_csd144_from_atrau_bitsosmo_rtp_socket_bindosmo_rtp_initosmo_rtp_socket_connectosmo_csd_ra2_8k_unpackosmo_rtp_set_source_descosmo_rtp_get_bound_ip_portlibosmocodec.so.4osmo_amr_type_namesosmo_fr_sid_resetosmo_ecu_destroyosmo_amr_rtp_decosmo_ecu_initosmo_ecu_frame_outosmo_hr_sid_classifyosmo_ecu_is_dtx_pauseosmo_ecu_frame_inosmo_efr_sid_resetlibortp.so.10libpthread.so.0recvfromraisesendto__errno_locationlibrt.so.1clock_gettimelibosmonetif.so.11osmo_twrtp_destroyosmo_twjit_config_allocosmux_xfrm_inputosmux_xfrm_input_close_circuitosmo_rtp_handle_freeosmux_xfrm_input_get_deliver_cb_dataosmo_twrtp_set_dscposmo_twrtp_get_statsosmo_rtp_get_hdrosmo_twrtp_get_twjitosmux_xfrm_input_set_batch_sizeosmo_twrtp_tx_skiposmo_stream_srv_link_set_typeosmux_xfrm_input_deliverosmux_xfrm_output_set_rtp_pl_typeosmo_twrtp_createosmux_xfrm_input_allocosmo_rtp_handle_createosmo_rtp_buildosmo_twjit_get_statsosmux_xfrm_output_set_tx_cbosmo_twjit_get_rr_infoosmo_twjit_config_writeosmo_stream_srv_link_set_tx_queue_max_lengthosmux_xfrm_output_set_rtp_ssrcosmux_xfrm_input_open_circuitosmo_twrtp_set_socket_prioosmo_twrtp_set_remoteosmo_twrtp_set_sdesosmo_twrtp_tx_quantumosmux_xfrm_output_allocosmo_twjit_vty_initosmo_twrtp_bind_localosmux_xfrm_output_set_rtp_msgb_alloc_cbosmux_xfrm_input_set_initial_seqnumosmux_xfrm_input_set_nameosmo_twrtp_twjit_rx_pollosmux_xfrm_input_set_deliver_cbosmo_twrtp_twjit_rx_ctrlosmux_xfrm_output_pullosmo_stream_srv_link_set_domainosmo_rtp_get_payloadosmux_xfrm_output_schedosmo_stream_srv_link_set_msgb_alloc_infoosmux_xfrm_input_set_batch_factorlibosmogsm.so.20abis_mm_event_cause_namesdbm2rxlevosmo_csd_12k_6k_encode_framelapdm_phsap_dequeue_prim_fnlapdm_t200_fnosmo_tlvp_mergeabis_nm_pchan4chcombabis_nm_att_namestlv_def_patchgsm0858_rsl_ul_meas_encrsl_chan_nr_strabis_nm_att_tlvdefosmo_csd_12k_6k_decode_framegsm48_chan_mode_namesrsl_att_tlvdefabis_nm_nack_cause_nameabis_nm_ipa_magicgsm48_number_of_paging_subchannelstlv_parsersl_ipac_eie_tlvdefrsl_err_nameosmo_rlp_decodegsm_band_parselapdm_phsap_uplapdm_channel_exitlapdm_channel_set_flagsrxlev2dbmabis_nm_dump_fohosmo_gsm48_rest_octets_si3_encodeosmo_gsm48_rest_octets_si3_decodeosmo_gsm48_rest_octets_si4_encodelapdm_channel_set_t200_fnlapdm_channel_init3osmo_tlvp_copyms_pwr_dbmosmo_gsm48_rest_octets_si4_decodeosmo_bts_features_descsosmo_gsm48_si1ro_nch_pos_decodeabis_nm_put_sw_filems_pwr_ctl_lvlgsm48_rr_msg_namersl_rll_push_l3lapdm_rslms_recvmsgabis_nm_osmo_att_tlvdefabis_nm_adm_state_namesrsl_or_ipac_msg_nameabis_nm_opstate_nameabis_nm_avail_namegsm0502_calc_paging_groupgsm_fn2gsmtimegsm_gsmtime2fnrsl_msg_nameabis_nm_fail_evt_vrepgsm_band_nameabis_nm_obj_class_namesabis_nm_att_tlvdef_ipagsm_chan_t_namesrsl_act_type_namesipa_prepend_header_extabis_nm_osmo_magicgsm0808_chosen_enc_alg_namestlv_parse2lapdm_channel_set_l1lapdm_channel_set_l3gsm_fn_as_gsmtime_strosmo_dump_gsmtimeosmo_csd_3k6_encode_framersl_rll_simplegsm_arfcn2band_rcosmo_plmn_from_bcdabis_nm_chcomb4pchangsm0502_fn2ccch_blockosmo_sitype_strsrsl_ipac_msg_nameabis_nm_msgtype_namesosmo_csd_3k6_decode_frameosmo_rsl2sitypelibosmoisdn.so.0osmo_v110_decode_frameosmo_v110_encode_framelibosmovty.so.13osmo_tdef_vty_groups_initcfg_no_description_cmdvty_cmd_string_from_valstrosmo_tdef_vty_groups_writevty_ref_gen_mode_namesvty_ref_gen_mode_desclogging_vty_add_deprecated_subsysosmo_talloc_vty_add_cmdsprint_versionvty_read_config_fileosmo_cpu_sched_vty_initinstall_element_veinstall_elementosmo_stats_vty_add_cmdslogging_vty_add_cmdscfg_description_cmdosmo_fsm_vty_add_cmdsosmo_log_vty2tgttelnet_init_defaultvty_dump_xml_ref_modelibosmocore.so.22osmo_tdefs_resetlog_parse_category_maskmsgb_alloclogp_stubosmo_get_macaddrrate_ctr_initget_value_stringosmo_init_ignore_signalsosmo_stats_initgsmtap_source_add_sinkbitvec_set_bit_pososmo_fsm_registerlog_get_filter_dataosmo_wqueue_initosmo_wqueue_enqueueosmo_log_infoosmo_ubit2pbit_extosmo_crc8gen_compute_bitslog_set_log_levelmsgb_dequeueosmo_timer_pendingmsgb_hexdumposmo_fsm_state_nameosmo_sockaddr_str_from_in_addrlog_reset_contextgsmtap_source_init2bitvec_get_uint_osmo_fsm_inst_dispatchosmo_timer_setuplogp2bitvec_set_bytesosmo_fd_closerate_ctr_addosmo_init_logging2_osmo_tdef_fsm_inst_state_chgosmo_vlogpmsgb_lengthosmo_pbit2ubitmsgb_datagsmtap_send_exrate_ctr_group_alloclog_set_contextosmo_hexdump_nospcosmo_sockaddr_str_from_sockaddrget_string_valueosmo_timer_scheduleosmo_hexdumposmo_panicbitvec_set_uintmsgb_freeosmo_sockaddr_to_strget_value_string_or_nullbitvec_set_bitosmo_tdef_getosmo_fd_unregistermsgb_talloc_ctx_initbitvec_allocosmo_sockaddr_cmposmo_isqrt32osmo_stderr_targetosmo_fsm_inst_namemsgb_copyosmo_fd_setuposmo_fsm_inst_update_id_flog_set_use_colorbitvec_get_bit_pososmo_daemonizeosmo_str_tolowerlog_check_level_osmo_fsm_inst_state_chgosmo_fd_update_whenosmo_strlcpymsgb_enqueueosmo_timer_delosmo_sock_init2_ofdosmo_sockaddr_to_str_bufbitvec_freeosmo_fd_registerosmo_signal_register_handlerbitvec_unpackrate_ctr_group_resetosmo_select_mainosmo_signal_dispatchosmo_fsm_inst_freelog_set_print_timestamposmo_signal_unregister_handlerosmo_fsm_inst_alloclog_get_filterlog_set_filter_datalog_set_filtergsmtap_sendrate_ctr_group_get_ctrlog_get_contextlibdl.so.2libtalloc.so.2_talloc_memdup_talloc_set_destructortalloc_pooltalloc_strdup_talloc_zerotalloc_named_const_talloc_freetalloc_asprintftalloc_set_name_consttalloc_report_fulltalloc_enable_null_trackinglibsctp.so.1libc.so.6fflush_IO_putcfopenstrncmpinet_atonoptindperrorinet_ntoasignalputsabortgetpidinet_pton__assert_failstrtolstrlenmemsetwritevfseekmemcmpgetnameinfostdout__isoc99_fscanfstrnlenmemcpyfclosestrtoulmallocsched_setschedulergetpeernameoptargstderrreadvgetopt_longfwritefreadfprintfgetsockname__xpg_strerror_r__xstatmemmoveopterrstrcmpstrerror__libc_start_mainrandomsnprintf_edata__bss_start__bss_start____bss_end____end___end/usr/local/jenkins-build/inst-osmo-bts-sysmo/libLIBOSMOISDN_1.0TALLOC_2.0.2GLIBC_2.4LIBOSMOCTRL_1.0LIBOSMOCORE_1.0GLIBC_2.7LIBOSMOGSM_1.0            W q  " j ii   @q:f q#'3 ii  0ii 7ii  #  A% < <4\\$|`X \ tt t 3  T V  z ~ . /  PB FxB B dB ;B fB B B B      m D$ J( , &0 4 r8 < [@ D H L P MT X O\ R` d ?h l @p at x |    w j H     Y @   , K b     x T  e    G    8 T! X! K! 7 ! '! )! ! !  ! C$! *(! O,! =0! 4! 8! Wh" l" \p" xt" yx" n|" g" |" I" $" " 4" %" H" 0" 7" " k" &" >" u" +" d" " " q" " l" D" " " -" " E" =" (" " $" {# # # ^ # "# # # <#  # $# h(# ,# 0# 4# Z8# s<# ]@# D# #H# L# P# T# iX# \# `# 5d# h# pl# *p# ~t# x# |# # Y#  # # A# P# C# }# # # # # l# # # # h#  # # k# 1# g# # m#  # "#  # }# # # u# N# $ J$ B$ n $  $ R$ S$ $  $ $$ ($ ,$ 0$ E4$ 8$ M<$ ]@$ D$ qH$ L$ ^P$ T$ FX$ S\$ `$ d$ h$ l$ bp$ t$ ex$ |$ B$ -$ f$ $ $ A$ r$ ($ $ i$ .$ $ $ Q$ $ $ $ /$ $ !$ %$ !$ $ s$ $ $ ,$ $ #$ a$ $ 5$ % % <%  % |% +%  % %  % $% (% ,% U0% {4% c8% <% j@% ?D% oH% L% P% IT% X% 6\% t`% [d% h% 0l% p% t% Ux% \|% 2% % % % % '% @--lƏ|ʌlƏ|ʌdƏ|ʌ\Ə|ʌTƏ|ʌLƏ|ʌDƏ|ʌ<Ə|ʌ4Ə|ʌ,Ə|ʌ$Ə|ʌƏ|ʌƏ|ʌ Ə|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌ|Ə|ʌtƏ|ʌlƏ|ʌdƏ|ʌ\Ə|ʌTƏ|ʌLƏ|ʌDƏ|ʌ<Ə|ʌ4Ə|ʌ,Ə|ʌ$Ə|ʌƏ|ʌƏ|ʌ Ə|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌƏ|ʌ|Ə|ʌtƏ|ʌlƏ|ʌdƏ|ʌ\Ə|ʌTƏ|ʌLƏ|ʌDƏ|ʌ<Ə|ʌ4Ə|ʌ,Ə|ʌ$Ə|ʌƏ|ʌƏ|ʌ Ə|ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\Ə{ʌTƏ{ʌLƏ{ʌDƏ{ʌ<Ə{ʌ4Ə{ʌ,Ə{ʌ$Ə{ʌƏ{ʌƏ{ʌ Ə{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌƏ{ʌ|Ə{ʌtƏ{ʌlƏ{ʌdƏ{ʌ\@-G0 RER @-P0  D,9 607R@-P0  6; R@-P0  (<< XxR@-PQ?  < R@-PO?  <= R@-vP0 = R@-gP0 l>  4R@-XP0 ? pR@-IPG?  ? DR@-;P0 lA -8R  --- 0i=`n<0 0 R/00CS/0S//OB LB $$AA/0S//LB LB @-@0S00B (0S0S @-3/@8@- ZdMh1` @  : 6 2 . * & ": 0:..dЍ`0 R P @00pC04 0CT=B l==: $!//C-p0 @Q@` `3 00,M 0`  "0 R HP p! A `0L  ,ЍC-@@0GB B ===O-@Mxxxp` PP 0  `p MP wP4j00@Ѝ$=>O >/0X0/>0Suuuuuuuuuuuuuuuuuuuuuuuu/// 0@-PMU@ PЍ0 L0@ 0@04 <00 B  W14 0 h1h1\ 0 L1#0A`0S0 P@V, @T1 P  0 0 0TeЍ萐p0 Vtp|Lh =0 808 ,pB SASXQrsSfS8lO-@PMi :1Sx  l`42Vp6W} PI40r0S7#L䱟`@s{P@M@ T U P@P P0M 0@u Tsko VO W< LP$400S bЍ  r [00`0 0 I 0 0 00 pL6 \0\@&$, 0|B pAPT XQS GR0T T(T0@-L@ MPS <40 $\0 Ѝ0XQHI- M00 U Ѝ- M00 M Ѝ-tMP 80#< AQڶ3 0< 3ЍD0CD BCpTxTO-pPDM001 :1S2 P`lU  [<0, 0C,0 @W0@S0  (0$ QQQPU PP00I 80 04, RZ @0 \( 0 0$ S i <  Bm\7[  CPP $7@T 5PO$P  0DЍ0 s#! (";Pb 40, I&Q Q !0 0 R84 ( 0QQQ \E Q  @Q0  Q0 PP08040r P0 @P Q 8 Q \0040;40S:84Sş< , I,0 84F 084@$kr$0 `@I$00$u? a$,0P $0:<04400,0QP\ $ P :4$ R d$. Q <  BR$0$0#$0 ` (O(0 0 3#$0 ` h3u`b0804 0$0 `0,0(%( ,0 0 3F4 R> RJ 4 B,0$0Q 4 <  B800 ,0R   R   R     ( 40<0  8 d840 084 4 0!y 084q!10!!! I"!800 4 084^84Z81PU! P $0 `P]P800P@c?  'x0 6$0 `p@00 p@ 0ctX0 R P x00Pp04 T0TONB  U4VXQS GR T(TVLUUUUTWO-@|M0P0CpSA$\L`,J[ APOu0  00 0  0 S  S  000 P @T Ps 0.@|Ѝ$0S T`R: !: 0 `  ! (P 0S #+R @ 0C0,0, <0#Ġ 0 P Y@|Ѝ$0Ss T`P0 0(!P0V, L@ 0`@LP T0L9@$0SU  TpR8!8  (`V P00CS`VC P 9L(0  0<(<8p$0S# T`R7 !7 0` ! (2pP07`V bP|_@L0' `tx l7 0`p\7<' 0 P0 ^ АX L@36ZX )P  0 C G 0C0( $c 0pj) i(|)p131a(])80< $ AQr30%3<  <(0`R&O&L&%0D0%5]:3+S@0, 0<0#@0 u< 0/&,&)& 854)L` & 5D&_'밌JH(00L00 0000)8C8<020P 00 C SRe@0S 0 !<A SC10Qßt+\0@,<,@@ P@P03L\`岖ᴆ6$TX @C 00 H3L@f5 p8i 00p $3$V(XS0  %0CĠAR#?A1c ! 0 0L @>$%0< u%r%o%@0hŸ< 00  L2"{ #0@0a 101! bv @Lg Dd0$<0%(@ *%'%$%@0D 0<0 0 1B  0`4 0 0| 0~' 0HuD0CD L xpB PLP WXQ TdVRBV@F APW@QgfffVtVWVxTW@-@M|P 80#<\ AQ ڶ3z.z> 0< 3ЍD0CD B XxTO-P,M0 4  S  S S p5 RK $P@=,Ѝ r@P :!$0R] 0 04l@#1 10H #1RR0010 000 00 00[`\ %pPa 0 S   <@PC0 R&   屐 GPP' N20P 0a $0 !R0#H %Q (!Z*j         [#pPpP @fPU :!R 0AS6"0  0"2E30@S==l`)0S@,0S1@10S9 S[ @T< 5@$1 Rm ?P !0 0!1@0! : L' J0L70S 0S0L7@04!4 0@T P `@ 00 0 wh@*P7S @l@`PP 0T@0D<@000 @B ON T(TR8XXQXjS GLUU4V'A-`M0Sp p!@PUE P1P@U'@T$ 80S0 0R40P

@P+ @T 80S 00Q @TЍ@

  *Pm?  +P01 #Pw R <P "0 0"201PU /P}/P}8Ѝp> \2R00 0R0 P $20P2" # PP R_ P !0 0!1q0!00  1t!bo 0R0B Py  \1 0PP1$!Nn30PS10140S10150S10160S101U000:U@"/M@{l0lP;0h`085808$_0UB dZZXQw[xZ,ZZ<[L[@-@..@- M@ 0`Pp0P0  ` 0 ` 0 ЍvvPO-,MP  1SQ t`plPW@1 6P0Sn pWZ pWA $0 @ X@B,ЍpB )@ `&0# BRииии|2 R "P&ЍT *0 SЍT *T *T * /C BRq10P1!s!0 0!1 0l!1 0t1`!ppuh!0 08!T1R~PP 4!?(!EScP}00 1Tl 0 0 03W00Q|0 R P 0 0X 0@404pX0X LB Y,\XQhB'(TRx\zMbH\u\@-@ 0P /A-HHpH`P@ p  0@U  |^p@-0M@`P,  0`0P0Ѝp@-bM @RP| .P<QK k:!Q) AQN`p00`p垱Z```` %$00p00\o 0Qh  0  0Ѝ`!0  01!cQ0S000@T0 P^ D`@P < 0$00 00 JB `00CS@H000080 /////\ R 01P/ 01P/Q/ /P@-  1S l0 0 j0 eS GR T(Tp@-@PM8 :1S9 lP 0 8< `:0 R P0 P Ѝp  0 0p p0Ѝp@) 00D80800 000( (B X`^S GR T(TP- M  1S l 0 S z Ѝ0 0 S GR T(TR 0A P SR  0 0 . (T.0S S 00@-@MTP ,PЍ0 / /` @P0 0@ =@ Ѝ0`000 ,B `^ 0 S0 S/ 3C 0S /O-hP$M0@S񟗤$p00S :1S lp0  0 (<0 X` 0 0帚PU 0 40 8<07 P0S P T P*0 0D*D:!0(*$Ѝ00Ss :1St lp0  0  `(<0 P i H 0 408<00\ x 4400S, :1S- lp|0  0 (<0 00` " 0 4 0 8<0$P$(88P1hU PW% &10'8$Ѝ ǟ0  J pE$Ѝ ǟ0 |00S :!R 47l1 `RJ|P(Qp !`FvPEp Q:0Y :1S l0  0 (<0 20 0 00`  p 000 4 0 8<0TP0SZ ̕PU> P0SB zP  0%4KP:8 0x50@Z _P0S TPw0%|$Ѝ$ R CPK ğ0 0S h4 R )PQ 0X$XX0P$PD00 0`4$0 0# 4`' P \#0 0p#3m`@ #008#3 ^& #0 0#`3Py8`@8#0 0 @$3">\`P"0$0x"2.V 000 0"0 0 "2 \`@|"00!l2  02> `@@ 1|x1 l`@@ 14{ ` 1o>0Sp00   `@i@ 818X000000 0xL IP:80DK@0 @4;~`00h`04{B ?X^/\L aaHaS GR T(Ta`aBa-O`La8a\a[DaWh l0p@-hPUl0P p@h0U P p0p@-@`P, L 0` P 0p@b 0p@-@`P, 7 0` P 0p@b0 0p\p 0/ -^ 000p@-, @P 0 P0p@b00@-0MS :1S! Q@P"h h0R Ѝ00S㗭 0S6 $0JS0L70 0 0 R LP ` 0 0 P0 hh% P`0P(L@0JQS GR T(TB be^0p@-@`P 0 `P0p@b0@-@ 00@ bA-Ph`@ p0W ,1M@0h 7/ U h0Uh0U P Ѝ00Sh0U` PP$0 00S P h`0` U`PP0L  0 P<0< -Ѝ` P hbB @bXbtb^O-@4M0#XPUYh#d`Vd$p% # $Z Ԅ R zP0S rPu YT R gP 0 PğH !4  $V%PP] $ hP-, pU Qr R <P 0000 0`#00  0#3h# R P 94ЍY P  3 (.(0  2" "0 0" =p{` ( ( 2 02\" _0ScPL2  ^ S R  Rn P `!0 0!15( `( 1t+l 1 0L!? /0 `0 01 j0 (0,, (0 0 0 ( 0( 00|  0 0T 0;0ph00q5`00H@0j.9B tc^[BAcI ?Xb>@cSbb9O-PM0p#H`@TV``*# [& % $ #  씟 R P0S St$4##0Z4 0 0d 0xl 0 0< \0n`00TL09B T?^+\^ccccd#bO-@4M0#XPUXm#$ R`$ f$ % # (\ t[ P0S Pw [UX P0 80$$ ,  -4 $$ P PP] ( hP-, `U~ Qp R iP 0000 0`#00  0h#h3H# R LP f4ЍX @P a \"0 0 <"K"0 0"2yl`C0_l00=`00H@069B tc^BAxd ?X,dd Hdb 04 08 /!80 SR !Q 1!#//90O-0MS^ :1S_ pl@lh h0R h1 RF 4P-:P7S8 811X! |(0@ `0 U[d R A@T` QU0H00LP0 Ѝ` 0 0 0|:P7S `00H<0<04 440, , zB \d^S GR T(Tp@-@QMP 0S Ѝph h0R Ѝp`V h:'RGd0 R P `l 0 0\ \0!ȧh+ C`00 0 B e^9C-p@MPs`BV% d2YX sP90S S-0$"$咃( 2免  BЍG?4 019Ѝp0S) S>0PSU= 1N㓅( ㅍ 1 |1t!xxp[pdW`!008!P1 J?4 01Ap=p 0,0 ?0 R` P0P(9B IPV :WP`00PX0, h<0<B ^!REA8e:Le.C-@PMR :1Sa q`lXP: P Q pWT P<`F$0Q 0 00 ЍC!0 00 Q  0Q 0 l 0 0` t00\ \H$ 808wB eAxei^S GRen T(T0 0 p@-@`w 0P 0 ` 0 p@_\0SR@-/Q@- R  ? NQ@- /p@-PU @  pp@-@0$ f00b@-/ DR /S@-@M :1S l0 0SЍ᜿00 Ѝ0 N0 IS GR T(T0Sa O-@$MJSRR j1S lpY,0SY l1SV +븢PS 0 8< 0(!*P 0009AP00L  4)Xn bPL00 0!$ЍOS 0CS$ЍOl" 10 1)$ЍQ Q !4|1PUK 0P 0L!0 00!<11s1oF ?o y v =  P0 0 ] Z  l0@0X ,0,RB zD^eeS GR T(TP 0!0@-@ MRP 0PU0 PЍ0S S7P 0(0Ѝ0@!+ h0@ 0@T0T  0Ѝ0@n! 00 0 B (f^@-.:P7S3 0@- MR@%  mP  R dP  Ѝ`l 0 0\ \0 R00 `00 0a/B df^70@-SM Ѝt0@ R ,P `L 0 0< u>Ѝ`00u 0 3B f^0S /@-P@-  1S l@0 0 S GR T(TP@- :AT  8 l@0  v0  qzDS GR T(Tp@-@M0S- :1S. P l`R- P 0 0(<4 70 Ѝp@l0<" \ \00L LL10D D8,<200B ,f^S GR T(T@- @P@k0 X /0 ` X/p@-@PhP hpg@-@;PdĥP?@-@0\0\A@-@%\0\A@-@  0X0`@-@ {p@- MP@`o@:< 00\0 $0ЍpT?0g4gp@- @R `M PH40@(>$0$ 0T$@ZLR0pO 9p@- @0 `+ P&40@>$0$ 0T$@ZLR0pO 9p@-M @ `40@P=@0 ㈽ЍpO A- P p ` X0@=H H0Dd$#L@@P `0O 9g@-@  ᠍P d4 , \(0(0 P?T?0ggA-M `@ P@[P4 P< lP @!1qT pԀ@p1@ T 0Q  Ѝ  T\P0 0TЍ $\ 0 0(ЍT?0g(hXhDdghp@-P @> 0P $l@ppAp@-P @$ 0P $l@xppAO- M P 0<P-  1S, p`R@  l嬰B먐耄 R 0 @Q 2T 0S   0 Ѝ Ѝ0( ((O T?0gAhlhhth T(TR@- X0<P  1S l0  0  O S GR T(T@- X0|<P  1S l0  0  O S GR T(T/p@-P`@Vp \0 0p@T?0gh/O-0M,,,pP@` T \0@ & 0S 0 0  TX0 S 0P  h R P|00dQ ЍXPL0` 0PsH ( \000 ЍOeA0gT?hh iiP? u0J 08c$dc400z@! [000%1S"@ H"@P| 00L0H _tH`0000 33B`"0 0>"IF`@@2 9"0H  00P"q>0H  0 " 0  0H L00S 0 0 0L0H 00  RX P 44x!0 0u?H!.`00,01IH-P> 00L0H г600S! :1S" l01S l000%1S@ @LH0 lt0H 0X XX0P PD0(0u|B sXsHss`ssS GR T(T0SO-P4M~ 0@S~ 0 S \\ pqP̟p H<@,2"#< - 0  R  $`X@C<pW P `p;0p@;+  `pP @ <0 0@ <0001;C80Sl @ PLT@ I\0  q4Ѝ%00 0H0 B$0&0 (0 R+D D T""" 8!(ʟpqxʟp l*d: 'p#< 0S{ L:@T4 P `@U``P, (*0t0): )9 #0#< 0S9 0pW7 P< `p.$)0 0p9h) +@)89 #0#< 00CS) 9 #0#< 0S pPf @0<$ 0R@0< 8 0 R MPp 0pW] DP8 pP2 VP(H8 #0#< 0Sx 0S6#T#!T%T%T%T%!'7 'p#< 0Sb7Z|Y 0܀ P `p$'0 0p =' \'T7 #0#< 0S;<7pW P:( =HpP <80#@AQ<@I3 03< ( 0 R:4#22*04|&t6##0#< 00CSX6 0Xn P,&$6  㗓#0Z< ] 6pW Pm `0(0E`p(%0 0 p?% Uq|şp I`)@ `5`\gT pPz <80#@L\<@qڶ30<3& ~U pP] <80#@L \!<@Tڶ3!0<3&! a8\4Z|Y 0܀ 2P `p$T$0 0p<4$ `0,0`(=( ,00 3 ) $`p)#00l#3{D3 0$D0CD B``  ,3,#0$  00"P80#L \ 0#0 S<# :1S l01Sy$ &`pW$p"0 0p? " $`F$0"0 02! `p3$00p 14`P&`p`p d1d @`p$00p <1 `$00 (1sh`$00 0f`$00 0lY&3$0 H0N0 0| |p9B sXst A@F ?untt2tut9pu_xTHu_.P feP 0&6{ލ Ѝpz.00(PP0M?  S` N?m_HSX!! Rp q/ S 0'7{ލ Ѝ0 R) pP  0  0p0 0 R WP  |0 0 l0` 004044^0,0WTvB 4w/xwwU@-M @@"xP l0 R !P Ѝ@00@04  Ѝ0*ԴB wxw-M0 0"|P p0 R P ЍD 0 08 0m Ѝ0wB wxwC-MM`0pPPH"p:04p@Pi Q. " 0p Xq010S 010S0S,pڍЍz.p0 Q W~qHzUq010S n010S; _n\ `P0V0 R WP d0  0@0L 000(0_xXTvPxB $xxwC- 4MP@  P@THPB$0hpW`@TApT T 0d"0@4Ѝ D2 1 (P 2 Rb PTAT1 S!8S3 AԑY  (H@P011 RD P x!Pt1(0) ,*+ 0 -L!0 00,!51S0 R3 P 0 0 000@0 0x\t0(0)+*0-0, 0<0800$Tv7B z&}hxpxxxwx|xP@-MY  1SZ Ql@ $0R`hp2 SP X1X!XWpp0D! 0 p414!Z(P0 R3 /PЍЍ@0Wpp03 0 0p n?Ѝ0P PP0H H<(0nB yyTvyxwHyS GR T(T@-M@0PЍ@t0 R PЍH 0 0< <0LЍ0TvB pyxwA-P`@Tp  fP  0X`{004`((@P@`B ztzxzzA-|P`@Tp  9P0 AJ44@P@$B tzxzzzp@-t@tPFPp  P 00p04 8<SpB LHEFS@-qMMH@ 0 0s (0 0vPqݍЍLHEFS @-Pp@-qMMP  PA 41RA00CSA B~P30 S: 0@ "0!8#( @T P0 8#R'  A %0& ## " $` #3` 0qݍЍpqݍЍpqݍЍpHEFS0@-qMM@  /PT h1R `Q  0PF0 RF  r 0  C %0 00 1& 002  03 @%0&$@0 "0 8#( Q\0 B0PqݍЍ0qݍЍ0qݍЍ0HEFS0@-QqMM@  P/ 0R/00CS-( I P!2 S&0 ,$0 "0!8#( P\0"8#R003 4C40 qݍЍ0qݍЍ0LHEFS0@-qMM@  yP< 1R P  0>P.0 R. "0040 000,$@3,0 "0,8#( Q^0 ( I2 PqݍЍ0qݍЍ0HEFSC-pd M@PT  0 4S S  ЍPdFLF4FDPxD`DHDBOMc@3,04R ^# 0 "0 8#( Q ^08$#R=p0  p@PW0;t@DT000@X;pt0  p@uV ЍN@2,hbCN@1,`0@*|`OMb,,@3,04Rx\! 0 "0 8#( Q\08$#Ra=t000@)RPX0;t@FDT000@8X;tt000@'V00 00 00 00 ЍN @2,|`M@1,`'0@*|`yD@TB +>vBO-qM,M@  P 4R S  0P2STJXGJ\J0=00?0001,'> 0@0 03000Pc  0B=?@ P 0p  0 P4 P` p90űš0PT0DAPP?x2Pj :0 \bQO=?P0p p d0 P4bP` p90űš0PT0app0q0P M A?4 P4?P` p90űšWP0L!0D\ 0 "0 8#( Q\ @L0 0Tqݍ,Ѝ0P0 0O=,00000003, 0=L00>0|00y?* 030> 00?0T00?2, 0'qݍ,ЍHEFSL>+BvC-Le MP@U@ 0 4S S  ЍP?,PPOMP8MMMKQ\e]ttP8P0 4Q  ^$ 0 "0 8#( Q ^08$#R  0%   Č $ 0;@Nw `0@Cl000@7`Y;d 000@&OW ЍQ^PC]sQj^!]PPpQ!^_|pExQ\f]bxb.P$P0 4Q\T"T 0 "0 8#( Q\08$#Rw 0% Č $ 0;@ p0@ 000@Y;p0  p@V00 00 00 00 ЍQ^C]P P`Qk^^PP`i{Q_x_t|`FsPUB 3+r 32 2v1 10 0vO-qM$MP`@  P 4R t  0HP1SUTDTxTPQV0 <.0004 0,d,4,$H`0 00  0!1P 0 0 0 0  &`P?3P 1P`P?y43P 10s? P` 0 P4_Pp p90Ʊơ U`0bp0q@ P  ?4 P4=P` p90űšTP0" 0\ 0 "0 8#( Q\@L0 0 Tqݍ$ЍV2 ?0E? 0|F?|!NV0/ k>00> 0€i?L!AV0, >00,q? 0? !4qݍ$Ѝ1P0l0P0S =0E? 0|PF? (>00> 0i? @C= 00x? 0?| f=<4, $0 X 0HEFSLr+v301v2 0 1 2 3O-@MP@@p`PF ~0P0>UP ! #  @U 0 } 0DPW@UW0uqЍld\c00Ѝ<4000xztzB zzzzT?zzp@-$@P DPPPpB P0/(}0@-P M:i?@SJ1S+ l 0! 0CS!1 Ѝ0P  0R+ S S SR Ѝ0RJ!R l !0 R R RJ1S l01  Ѝ0J1S l01  BR0!(} T(TRPd0Sp@-PPP<@ `V00p/pB }p@- PH@@P uPs@po@B } P0 0//~0@-@ MPPQ TM@D TGZZZZ[@[[h[[Z$00 Ѝ0 AP8000000 04 8<0 04 8<0 04 8<0 0! 40"0# 40p@-@M`YPP TD@D T>(\T\\\d\\\\\\\$`cЍp P `*P ``&&(&<` 0&&(&<` 0&&(&<` 0&4 `!0&4"`#0p@-P`@P UU UyP@1 ppppp@-@`PP TT T@y R !p@p@ @@p@-`M@P gP SP   Lbx0P Ѝp  IX}B }@-@P 0! 40@-@P$00p0P d0P Q T0QP/P 0CP 4/00P(/$/ /t~\~~~,~D~p@-PMc@P P`   gy xmЍpX}/@-cA-@Pp`RP tTOtA-@Pp`=P0S 00 0=84p@-@P`&P00+&p4\1O-,MX`P@p: P P @@ 0 ,Ѝ  00 C0p DH $,ݿ$0  0CB P?L\[< 0A-S) :1S* l@P: 0P`ؾ 00p0p  #0 4 0$ $$0  ``S GR T(T/ 0A-S :1S lP@ 0 @p`喾00@8 0r0  0  $`S GR T(T 0p@-S :1S lP@ 0 `@j 0 04 0p@D0  0  aS GR T(T 0A-S :1S! l@` pPO 0 90 0  08 00  ~0  yx`S GR T(Tp@- @ᓿP㏿p( 0@-@MQ; <  BdPP3UP ! R= PPЍ00@T& P ڽ 0 0 0 0$ 0 0PЍ00` ``帽 40,嘿0P0呿PB LURO-@DMTP[ T 3 R \P2 `V`r@(ើP<0@80<@ 0< 0CZ0 ,PY PK 80#<L ^p-3 0[<3- [1 Rp PX1 uaā`  BpXW 80#<L ^D0CD B\冿  @1pApWDЍ0PU P  0 0 0C 00| 09Z 00T 0/@X00þJW 40 庾B |LT(xT\,G-P(M@+%(ЍP ,$0U P   <0AS  R P0 403/,03/ ѽP($0Up% 夀` 0`R  B X W$0S  8޾(Ѝ$0S0LUR O-\BMA(P`=pP-PJT  2 `5 pPI8@'pP1Q@@ 6P101 `pPp6Ѝ1@TO P \!0D0 PL1L!TЍ 1PU ǿP!J\e Ѝ \]0\0ЍV00Ͽ@` 0ÿ׻x 0D0 @h0\ 괿ȻP` $0$ 妽|gfjB x`A-QaTPp@p㹽\@\峽̀勼긁凼|@-A@0 8 TM 0$  Ѝ8C G-QM@@ Q% 0R R2o \P `U pQMP 0 p`!ЍP!1^p `P@@20@`Pl! \̾TЍ 0 $Q$1$\P p`1  !  0Pp`  嫾Ѝ\P `p     0P|  p呾hЍ\ P` p4 0P p`0 zꔂ8C L1#R-!<A(0^ksdsdssssstttttttt8t8t8tttttt`tttttsLsLs41 ,͌<0SF P Pw 0 ,͌<0S6 APQwR ,!̌0P Pw| ,!̌0 @P\`wH ,!̌0A QPw  ,w!̌0 Q90S S 0/0 00/0S S  00h/  /ḁ0S S 0CP/  /0S S Co/  @o/ 0S@o/C0SA0S00 R000D0/@0D0/B0D0/A-skPowOpM@⠈T0 00 0A0C0B @ D p@-0MPSfwwvvv(wvv ЍpoЍp01(R@@  ) !@ % .T1AЍp0101(R8 R  R2 8S4A5P r 401P  01  @ 01 @ j1d011P >P M0 f &ԅR 0@-01M@0P R 1PЍ0\00P@0L 㦻Ѝ0Ѝ003B ԅ 0@-01M@  Ѝ00P R PЍ0^H00P@08 oЍ00B @ԅ01/p@-Zf< M Ѝp@PlV0 R7  P 00`0  90 00,Y Ѝp<S 0 R  㡼P h 0 0T 0 0 00,,0 婺0 夺B ԅĆ 0dS /0rS /P/01/A-Z~< M Ѝ7@dS p `* ΅ P=X1 R[  NP l10C?`! Ǻ0 00,o ' Ѝ7rSp`g`Vpf0 R)  &P 0 0 A? 㞺<S 0 R  P 0 0h p0 ㈺0 00,@0A4000 0C B ԅĆ@-( :P@ <0 0@ <0H0@-@M<8P 00  0ᔻЍ0 D L0@-PQM@80@ BQ(ڶ3U03B00@0B0B0B\' <0 0C0BЍ0@80@ @ Rڶ3 @ 0@ 3 @x @⵹#<ADD B0C800 00#<AD hLUԇR@-80@P`EPM@Dڶ3pE03@pp E00E E}1QP`; x!(1`0V HPЍ@|U`,b(!0D0!0 ᴹUpQp 0@#< @DPD B0CP尹00S PЍȺd00`0L べỺ ,0HP B  ^h0-G-|QM@Tp<`H ݺP#@@P`04!ʹ `0  A0S`( úPV4 b JЍGЍ/@ط 00 ^0 *00@d0` ! X0dD嵸0幷 $0^娸 B ^$T?0@-PM@ ѷPK <80#P@L\@

H10`<1,!2 101  C 00  0l  x0x\_ @0D8VDD B0C0ȶB ^%LUԇRxTO-xM MX@P` P, Q8 <00C0C(H囷 PKlQ 6S  $2#( X"*1S? 7/ ލ Ѝ᣷'0 0'?[ Q0'j7 PU ÷P ့L70 ?$'8ލ Ѝn(!0PP&JP ?S- @00cR00S .R :"-0S )R Q QXx rPL:\ QT.X.1S =0S$1S . R :-T1S . R :H-0S (R :L-0S (R|1S ^/ R = b Q =0S $R=!$$ |0S 'R XPU P8-Զ 4x*0*@=D=D1S - R :--lQ 6S $(""44:t0S' 'R$ :-00Y00 !<(AQ @Q qP_ s;[㇯0Yl3$ 083$@埵P43/Xt ᧶PA d"0 0"24R 0 C<R*\T>QX>!PU\ ㆶPj C00l2l" ,"]L#ipWU iPM & 2囓#=!(0  0!1ִ8 :M-ׄP ЄỄ X18Zl10d1 ,1,J 1 A !0 0 1㚴յ0囓#= (00 0\#ĵ 08ỵ p0pB `E ^LUԇRXx̉R0L܉DG-MpMWP@` ̵PM QY <00C0CT Pp,zp , 0@Ps\,V1,pS - R 0p0W0 㖵P;p(1T( DQ% Yj @T ㄵPU#ލЍ;"0 0"F> Q0l"ll0d4 D2PAP{ $2 0=!γ1/YdލЍ 1FTkjQލЍ!0 0T!t1㣳0 >!" * Z㰪10:  1 @T* P#ῴ 0tᶴ00 0x W᫴ 0 0 0L b᝴ P0PB `E ȋ\^LUԇRԋ|@`p@-@P00p脌@-@@ P @ <0 0@ <0 @4 Hsˀ0@-@M@0-0\ A RL<TT0 Qʀ *1l;4|>04 08Ѝ0-@T Q 04!R01001Ѝ01S  ʃ!l+0*1l;Ѝ01S  01Ѝ00P@T =P  @\ 00P P0 㰲 PP 0> B ^O-Y0MYMp@`  PK QW <0 0C0Cx唳P0S 啳PI PUn P ᪳$)0 0)9bލЍ0SY PU ͳP ኳ(0 0(8B}(0 0`(p85 Q0P(PPD R- Q* ^' Q$ L\^ Q[QiPU 㐳P- M007' ' @ x7|p喱PU, rP /d'0  0L7'ލЍ 6oF6/`kk<0 6|YPU 5P 0|&0 t6 0S #P 0<&0 46H 0J JI  0$ S 0Ʋ 50影W  P0  0pPS0噯00S (R$2Sk ". Rg 0@ A00S 0@ 0R mP PU  ŲP Ⴒ0@0 0 4`$5 ^j \4\Aa (4 巰8PU 㓲P P40 4# 1k<3 `咰A0S0S kP (A0S@``l#00 `\3"ذH0S 0S LPs0SS DP 2 "2㾰28 0\2@PTPPE gPG P Q: yP6 PUg P ѱP4"0 0P 2!ヰ yἱ 1\m1 D ᬱA0S@``|`t1 p0 d1IJ   = L}I J00 1 گq{0@ 0  0Lͯn`B`  0徯B `E ^$FLUԇR4<*Ԍ|/ԍ74t@DRxL}bp0- MR qP d 0 0P0P LLH@@4 Ѝ0sB ^t `E \ 0@- P@ 0P@ 0Q@-@M> Q4 +Q   Q0S0S;T 00ЍQ 0ЍQPT 00T00ЍQ>P<0SX0@ 0P   R(0 M/ t0HP O-P!MPUMX @p`W ӰP=<0 pPi  Q <00C0CT@TPH?aV >ⰠZ (?/ S!ݍЍ @P @ <0 0@ <000CS0$00 0 P00CS񟗭긾|ܺ<Xؼİ@ Գ@P,dж4ȯP&< 3 B0C< 3PU دPb80@ BQڶ3B03@B Y`3:80@ PAP ڶ3A03@ Aᘯ80@ BQڶ3B03 D0@BB0B 2P@T 㚯P =R:0:* 00C?o2P0S0\*!$0!<(00P, 唬0$* 0P ?D*@T ZP 90p9)Э<l!ݍЍ t9t \l_(X _(0 D9t MX00)00 ŭ#<AD0CD B嶭0S90:4!80#!<LN\Eڶ3.03 0< 02 ?o2R0SH0S 80#<AQJڶ3 030< 00S80#<@ʌP"0ڶ3 030< 0Q80#< @Pڶ30 <3- 80#<Q @aPڶ3-\0 "P3< 80#<Q @aPڶ3 0U3< 0S80#<@ʌPڶ3 03#0< 080#<@Pڶ30$ 3< 80#<AQ ڶ3 03< 0Su80#<L\ڶ3 03< 0 0 `r0SZ80#<@ʌPڶ3 030< 0\QD80#<N^Phڶ30% 3< 80#< @ZPHڶ3 03< 70S80#<Q @aPOڶ3 03*0< 0 ?o2R0SH0S 80#<AQIڶ3 030< 00S80#<@͌PEڶ303,$+0< 0 $?o2R0S80#<L\ڶ3 03-0< 0 ?o2R0S80#<@PDڶ3 03@0< 080#<AQpڶ30A <3 80#0S ဥ!"442<5S S. R # # # # $ $ $ $04dQ V>0S0T0P#T #0T ST0:T00 R#T  0T SlY V>00S5S - R0Y04  03@P@-E B/P庥@T M垣@ލ Qf <00Sa !"442$Q R>0S,Q R>00 Sw 3  02@奥PDP| 2ҤQ Q>00S ̤!"4434X S>0SP X ;00 S T2  02@qP 㻦PPލ! 㪦Py 4⪣ ⦣ 6⊤ ↤ZM )ZI;00SD 0;3 v q 4₣ } ᴓᴛa1; [00 U13 N!"4410 4D!"441040X0 *8APR괛ᴓ 0uB `E ^LUԇRܑ^O-P$Σ$0PU BP $0 0 4d$㶣RލЍ0T$TTã`P[ 4Qp  ,?<Qn  *92#TTX%X\4SWE  ,d똀M 3 Rw `P44S <4S \4Sv ލЍX僣0P#0h 0 0",3`[$ 啤PA P$ 2z'20S| 㾤P` ,D 2 0 Pp2H"`.lRg00 (2(廢i`8 #4<`4#,0x 2 10 0hp20p1|`嘢80#<@P;ڶ30z 3< x80#<@PD+ڶ303%$~0<P 0a80#<AQ"ڶ3 030< ,0 hL,͠0 0  0`lUE4@`V Pf` 0P 0 P 0Sa P 20 2ޡ@P?@:@5@0P\ 0S* @# \2@@l @02@S1Ye ὢPJ000! ! (@n!0 0!1&`V; ᜢP Yh!0 04!Z> t3@@B 1嘠c@0  / 0 0 0" 0Z\x p0p8oB 4LUURԇ  L ^Pԓ̔ A-P@p`Sl JP00  B0 0<0 0 60U0 U ,00 $0 0  00 00 00  0 0 p@-@P 01ZP 0040 00$0C 00pHP   /0! % ,R 0@-PP.\M  \$  R J = LĠ S̈́ 0 R ㎡P h0- X X0Ѝ0D@aB0呟UTB 0XgfffO-P@ ᆟp00 ɝP`  x` 00  ẝP  ᴝP 㭝P  ᧝P  ᡝP  P00` F00`Cp?긕C-! Mp᎞@Pe ӝ1,0 ( -<,@`0@Z0 *,q= =mpٟTן0 `H婝D㳍 .0 ` 坝}  p"0 0 `劝  0 @q$ ޞ  ڞCP0( : 0!㐠P  ЍP0P PP;H@K` 0HP ) ,9 p<< = xؕ*XR00S (P 0Q/P/O-=J0`T==m PᢞP )0[ ==- 0]dpn~/^>.ͅ徰ἠ Ⱐ.n$(ߪ $۪p`>M K/?2x@-D-名呍dᱝ-X>   1dFP 喞 咞 厞 办 冞 傞 ~ z?00>PDa(s R0 =,0l?p? Px+ =0?? P% =.\40 P^==^ ^//ʜP!p00`0` ``D\0L XL?P08 L8:,DP `M 9 ,XRԗ0@- MR@ ゟP d 0 0X X0,1.  00 RЍ@0 儝B XQ@-.P l 0 R 0S D0000P@/L b! CUTgfffC-Z= A1//^/. 4/0@-0M)S@P)(S * CR wP Ѝ0oP0S )S 7S7 S0S; !S Z@oЍ0 CROP S S S PU$ 㟝P  0@  0@0 (S0S !S S      0 0 咛B pX0 S S S /}S :S/0S0S QS XS PS@o/(1*0! R :--  R !<00 s; Q  R? P/0" /</O-PMp(徜x2P @T P^EЍW)@'`Vf PO {Km隈:O.`₟n!sKOsk To4 P P PFp0SF@TW ޜP "d10 pX1X! Q410,1 ! C^Ѝ324ZS024hW0 00 p@0 & W000p 0d屚 P0P@娚^vp 0坚kB Xthlh0p@-@((PPP8` (PP P 0 0p0HP O-t! Mљ@PU `@(0T!(0,00 @  0P$pt`  00 00 `  j> P圀0  Ә0|MB X B0  P UMo Ѝ ` ; ? (l> 4p@-P\P 0\04P 040MZ @ ]`P `sKOTpO-!lp(`  DP pB@D80 SACԱa! wOP80  PdMU@pskWof0$ $$:u0 5D\hRtO-mtp p<`Y s[@P @<P 0)0Sp0 庐R, ᗒP 00P0 `000墐D@D B 0C#< @DD B 0CL404 児v ЍB _s Ddr xTh0p@-`P@,]0 p@LA-lBSpM`P [ Rj ?PA0SJ 7P/冏P} <80#@@@DT<@Rڶ3 @0 3<@ p 80@ B\Mڶ3@B03#0@@BPBB0B`ЍA8\!00P!P1@1`  $!,1u0Sp1 R- P 00P0 [`000@D0CD Ba#< @DD B 0CPS808 Џt ЍB _ZDdWYxTh0p@-`P@v\0 p@IßG-MP`p0P ㉑PU  R <00C0V0W0 8 #P:`ǎ@P 8<8##8@L\<@ڶ# # U<  Qt <00CS80#<L\tڶ3 030< 0V 80#<AQ_ڶ3 030< 0W 80#<@P}ڶ30 3< U Q4 < 80S B< N\Pʶ3& 0R 3<  80@ BQEڶ3B@03BBЍG41 ,!,1eUZ0^0!t 0JDD B0Cb0 ]00D0D B0JRDD E#<AD0CD BD= ЍB LLUURxT*th 0@-0 M0S@ # S  @0dPᚍ Ѝ0~S 0!S )S0d lP0 @dPS0@ dP0d PC-@MT8 <0P0CS`000S& "pP; 0Sc0S] 2XN 0P MF@P8Ѝ儏 L2LH7@Ѝ0("((媎`p"00!2 ㅎ1`V P Z10p1!p000 aM`E d1dHW$1X5 ϏP `p.!00 1 C0 bP"֌@0 R 㯏P 0 0)0 oPἌ@v`pp L0L(寍<0<媍B 7LUURGШ=* A-RM`G <0P@p0CPPtP0S= tP: T!RP@@ >@T@j0 yFp0 jލ0`V- GP@ 0oލ 0 0P0 ᳍0 ō@ 0d`0` 1c$00 0/<B P('LUԇRL A-RM`I <0p@P0Cpp`⍎P\1S? d\< !R   B/o`1"}Pލ0X. ֎P@ 0o6ލ@ 0h.ލ 0 0p0 :0h hhL@ 0d$00 0彌<B d(MLUԇR O-RM M`h <0P@p0C8PP,P#0S4 4Xb yP #3 0P:>#@ 0hPލ Ѝ3XT XP!@ 0oPލ Ѝ1S& r/ R" 0SE S0Q >0SJP{"2 0P2"᪌0"弌@ 0dP`t20 l2:d,0@ hpPM(20 (2(Q >0S @ 0eVPP1!姬@1!P jPr:=-L S k tpPM$@ sk@0D0CS0S M@ Ts⇏ XOp0WPKX 0  O8#<0P@P0ڶ# # <    嵋ṍᬌpᴍ᧌ᤌD0LD B0<B |h(LUԇRpxT A-RM` <0P@p0CPPPEdP >pJWd2} R| JPD< ލX` 7PH 1-d!? 1c!cQ00==0#=`!d1 Waލh1`VD  P@ 0omލ810p?(!~A!1 0P1 p>dڋ00P0 b0 tɋ 0|l0hX00 P0P<ފ0@ d"<B $I(ȩLUԇR O-RM M p` <0P@0CPP.P@<0S4 #R1 I0 SP0 0(1V ATi =0j 嚊F/ R0y01Y P09(Y 2@T cPOލ Ѝ@ 0dލ Ѝ2 RN MP$@ 0oލ Ѝ@2 R` ;P ` 2 0P 2 "㲊@ 0Oލ Ѝ1 01`  0P1!㝊0!寊H0Y090@ 1`  0@1\!ㆊL10`00D<10;P 1 R6 P 1`  0dh:`000Po _p@ 0 hO1p0F0SP1AP`00@X0 T׉``00D<0ω<B 2 () LUԇRTa (R  C-RMM ps <0P@0CPP@(P<LQ0 l0S- $0S* H CP_$0l`@ ``F[Vn@ 30C`3@` 0 圊1 RL dP.~ލЍ @0dލЍ@1 R< KP @0oލЍ0 00`  0P0 㷉$0 00`  0P0 㪉0 弉0@ h$00`00h`0X/@00`008004& 0,圉<B (* a LUԇRG- ` 0R0Mp <0P@0C PP,yPY0SE (RB   zR㉨ ϊPiPZW:  =(0* F/ R0c07φPˆ0@Z R 㩊P @80P8 0(2`  "2  @0dލU88yލ1 RM P @0oލ1 01`  0Pl1X!0X!XX P1`  0P<1!ۈ P R0 LP ` 0 0P0 Èh`000Rf00`00xp0`I8 0P80`008,0,<`00D<05<B  У( LUԇR Ъ G-sM`@VP PN RZ <0`0C``X冉PU1S @#`y> RhY ىP0hP 9} aV "ӉZB? R:`V 㺉Pf0 hP d^`ލD20@"<2 " R0"2pWn ᑉP'0P o`ލ  `P⻍$P 'P = 0P l aX!X1 0`L1$!݇ 1oV101  ȇ000  ệ_~ 0lLuu 0HCMlP00 H0H8B <t<4LUԇRh(7ЪY(G O-RMMp <0P@`0C0PP勈P*$1S t(P00U RჅP9@8 R  ۈP $80P ?(S@ 0h2ލЍ7pWJ P@ 0o ލЍ'7 0P7x'+lQU< hQHU[k 㚈PP[W 㑈PY YHl1$ 0 ,0 0$0( 幄4嵄51YS Rx pP 6 5! d&t6415Y:YSI RW WP 0051 0 64! % 6ˆv0%݆>s# M?0+s lZ0!0)0I0! S!NNQNLLLLLLNL%01P 9U01> P,Y  Y Y  0] <ލЍ01@3=0 +4 l01001 0S0(18@9S P 0(1)B;IQY   \P4EA@ R ÇP 51 034! #?9 ل3(@?t#P ) oN@ Pڱ 8 b$  \H@|J  \y 嫄30 P3" 20 2勅@ d@T? >s#0!)M?H00!+ 㐄T 1 #u2@T0 KP; m$20P2!. `P 1O UP 1 P\Ax1D;L hA p1p1`a@c +E4 `l)017010)0   (  \ 00@0P a h |0|@<4B (N<vLUԇRh$ܫiG-M@pPQ2@@Y` 㥆PoP @0<0X@00<'80#L\tڶ30 3<p 80@ BPmڶ3B03~0@@BB`B0B000ЍG蠪80#NPdڶ30 3< 80#<N^<=ڶ3,,,$03< 岄80#<( N^ %ڶ3 03 0< 0<` 00  ᩄ` 08vD0CD Bh嫄#< @DD B 0C4坄 ЍB _4a xTh80#<0@- N^,M@ڶ3P0  3$#T`PmTQ P oPr?!aPt/Pn/Ph*495i0$hN@2 R@l ㇃P]րP4 @ 80<pNW@$ᒀh8D0*01M-\P 0T01 {;A6s;A@0C R D%@% @%=0Ss;Q@T\3@T P{8 !ݍ Ѝ,0s⇏XO~40< 040So00@T P D~ 2 02" 4@( @+~ X$d~00 0 0X20`P20"e$~00 00 2 V0!@100@1$~@ 1 0@1l! D\~p10h14! u$$x~@ 00 @1d00 0CY01 ;01+l~ R|000P d\DlJ~ 00 \0\@8;D<>~ P0P.1<4B >8($ VLUԇR4jO- @ 0M0RM`O <0pP0C pp偀P0SF 4 R) ހP ` 4 0p4$U P0O4ލЍ4 R €P P0o"ލЍ`00D<4@~84 044`  0p 4$'0 $  91S #00Y R P0hލЍ &}p5 |PUP  WV⸧ ZcD30\% 0\%  +} ~M ||`5P  0`PU RPZ2 Rd GP 2`  0p2h"~\20`00TL2@N~o("\5` 7V\5u %P $`@F}202@P !~F10 RL  P00 +}10 1d! y~l`@}t1PPh1 PdN`00 1}K\5 ;\5+ }  }00i`@|@0 } | 0H}=``@|@T0 P}<B \w L(r LUԇR4| $Į  O- @p 0pS B#Mo`RMA R <00C P_ R jP?DQ  !=0S0 0L8S" !- R 0Q4$0 LP >$  />} R#ݍЍ0$0d8(0S 0Sn -PTX 0S| "P0S: PY 0SY PܣZ ?0ST䳝[ >>0S:0pS00 XY00T(R  Q"",4 [ 00~00P@,0S R* ~P ,00$= ``  - =M}0 O#ݍЍ0S ~P <  \-<4}0S ~P <  -p<"} R ~P D< ``  ,,<}0 d#ݍЍ; R }~P ; 0;`  0;P,|0 o#ݍЍ;  ,;|O|;  +h;|2(0 P; +D;| 0$ SR000G @`|0@ S  5~P z: @+:| `:`  0>+|: *:|0Z:q oV0 0pS L`V R3 ~P ` $: 0`:h*x|0 /90) |``009 |y9  { R }P ` 9 0`|9)M|00 8 {(0 009t {00 8T {00 84 {00 8 {4( ,(8|``004,8{ p8 l{0 7{E70`007d{X6Pw 0S$0S<0 0 24 0RN0XC \0PF0 (0S0I0[0H0H`#H8&h8(pV#4Ц<[h#p :}P< b8"#4<QbT# -}P|zP> <80#*P@ HX #ND0D B0G4xD0PD B0Gx Ѝ_hxTO-M`  p:wPz @8P0< CR@00| uЍpQЍp@rЍp@c8V`00  0 $0 guЍpB <H O- PMRM <0p@0CPppxvPZl`V `?oZ2L58 ?@T vP) `@@t?0@ph?h/ @u`Fp`00WL5 ? R vP ` ? 0p>.#u ލЍ1S10$ RU >@T vP!ލЍd> R }vPoލЍ,4>0,>. t> 0>`  0p=-t0- t= R OvP ` = 0`=x-tdލЍ,0S0 S V O PBPfO0| <P_?\#PXQ Pf0F800SO%t0Sh 'Re 0D x< R vP <`  L,<ztOPk ``?` < tG៶ < sT;0`00; sZ`00; s.`00; sO!< 00(R H+z 19R09 uP 09 0X;`  +D;)t|0S +R : ((ᧉ1S . R :'LQ R? Rv: 'TQ > R: (1$0SC R, (pS 0D0<@`4@D:  Y ,*S04@ @0hh q`o N VVN@v X d9[ =uP\5 f0\e +gr Ns$0( p0W],0Z:0<@`D4@<"Px R uP0 S 80S0 0S ;S 1S >000d0J057/IPZ6/cPT49 5) 80059 00CS(3kZ< <PPcH\5 ;\5+ r  r0S )R *P0Q7q70 p7' +sl6 R tPZ 47`  & 7sPq 6 rK10CSWlxu00Y% _tP 0R! `VO StP=0S:SSw=`V BtPmPZ7SG 54%Tr0u0u0tt R !tP0 5 $5r0 $Kq (TP 4 R tP 5`  X$5}rhSn 9Pr 4 R sP 4`  #4br30 4@RG sPv 84`  0`4#Krjp30 4@R  sP_ 3`  <#36rU @0h@u _`30X3" r=:0tPa[`002qC@TJ sP 6@ 334" qZ :0SZ`PRP`P; `V WsP  h20\2! qCPs @ 0  18Qq` ( pOp$Kp$ 1 (  0 `h1  qʳ10 1  qέ 0`q0`000@qNF R013`00TL0q<B Ȳ,(LUԇRT4L$0 Et ;|T \[(Ъt$ش}سudt00|0(  $q_`000Pp<P 0tpO`000p+`0, (0o$oo$00(00 `, 414pa@T> hrP @<10 P@X1H!p`001tnpU`001gpN1ap0 1Wp`̲` 2JpP$2 8,@p@T& rPG Ѳp20`x2p"pY rP ἲ20 `2" {p᮲2  peᤲ` $3$(pA-MpP<1 R`A qP1xx%oPV <80#@@@DT<@1ڶ3 @0 3<@ p 80@ B\,ڶ3@B03$0@@B`BB0B000ЍAՕ0`  p0 p`0|0o@D0CD B\!p#< @DD B 0C(p ЍB _xThO-@MPp`P_ `qPHnPi 80P#<@崰JX㩡p q7ڶ3 0< 3 ` p80#< N^$ڶ3 030< P080@ B\'ڶ3PB03 w0@PBBB0B@ЍOH0 0oD0CD Bto \0`Xo#< @DD B 0C(o ЍB _HxThG-M`PpPm ,n@PC @0< 0 @00< ;80@ BQ8ڶB@! BBBB#<PISYP0 -0V< P0(10ЍGՔ80#<@P#ڶ30. 3< Ѝ#<AD0CD B\oDD B 0C<oD0CD Boꐧ_hxTT2A-@MTP` Q@@YpPOm@P~ <80#@(pN^!IP }=P 1<" !1vkk<200j} 0>.(",$  8#" h[0#3SN0 RJ0S 6S D`ji `20hB1pWW iP#j89S RV iP%8 g8Y@ ` 1`  !1ZhQ`0Hx1gJ``0i1H1H! Ehh1`  !T1;h0 R5 iP 1`  1'hf@``i` 0g`000pg`00tl0TgDD0CD Bph`00\T0gB  RLUUp@7к;xTO-`P$M  Q@  PU  <00CS" R KR RS000S /P + Y 3iP!0H*S񟗝tttttt  R7 ~RdSb000SX .P  ~Y hP0sS wSy pS{ Rx hP0 @0a8Pe$Ѝ$ЍOt000SH `S| - R hP0@ aP=`V hP  h=0=P.g$ЍOT= R' hP0 `@eP$ЍS000S 0SS,0P |Y1 ihP0P "P J0PQ PuPUP$ЍP<-LL fH<-D8 f08,8$ f9PP PT1P 0`g;;, fި 0e ;8 5f`f l;x *f&`PP PHH`o媢 R gP HX; *  :0` 0 :H+^f PPy `XpPW9 gP |p1H:0 p8:*7fPVpW gP @0a PPBP>iP9P5 R gP 0 0`9`  )L9eP49  ) 9e9t eUP P 0`7f88$) ei 0 0dD80 48( e`f 7Me7 R  (gP 7 \(7e0 o@5dPP, P,7`V gPi d 70>]6`V fPZ Yf6047N07  |'7je. R fP 0 06`  ('6Ue7PspW fP 0`p$f6x6 & 9e PW.PR06pd 0 06`  D&5eT50S fPo 5 &5 eg5 R fP^ 5 %5dV40S ofP T5 x%H5dcP 0`004@wd0Sh R  PfPHX  90P0 pW ?fP 4$HX`Pͦ|4(p4$ d_PVe 3P;d3<6d0PCue <3(dmc 3dd 0`be p3pdN 0`00D<3 dHX :9 0`pHe@343"<34HX  `20 0x2xc 0`(e 2c 0`00802cl2 hcFL2L|c02 ,dc)60Z HXwNjPU PGw/ h1hc1!HX`P  1cFQP$pHXd100P/ 0< 0,1a긾p@-@P p@d01PbbP Ƞ,̠Č  appp@-@MT` ` XaЍp P0@@0@ @~b&4d  `dЍp04S fd/0S d Bd0S b dA-@MP &c H00H0Ѝ Ia 0 0 0d`P aPP) 04 0S ,00,08a bP $0 p0W$0 0ČȌ̌47/a(00(0a00000 a-\M 0 0KaЍ4 0`Ѝ@-@T @b |a\ a@-@ 4a(!4"$,8a$"#8 0P/Q\bC-pdMWP 0,Ppc0 bdЍ 2bll@ ba R@X cPI Rm cP5 R\ cP0S R Re qcP;0S R fcPe0S R [cPN0S R PcPL0S R EcPh 0S R :cPQ$0S R /cP:,0S R' $cP00S RL cP40S R; cPy80S RN cPb<0S R= bPK@0S R, bP4D0S R bP R bPk0S R& bP 0S R bP(0S R bP(0S R bPm,0S R bPV00S R bP?0S R bP(0S R bP Rv zbP '0 0'7`H 0c1! 7'`0 0|'0 0T'd7` P'0 0$'G?`(70p7&`6Q` 0 0&0 0&6`00006|:` 00G|6`3`H0c1 <@6@(`1P&0 0&<6`(&0 0%6v`$&0 0%5j` %0 0%5^`L%0 0P%5R`%0 0 %t5F`sD`%0 0$L5:`@8%0 0$$5.`<%0 0$4"`8$0 0`$4`4$0 00$4 `y0$0 0$4_b,p$0 0#\4_KH$0 0#44_ $0 0p# 4_0#0 0@#3_,#0 0#3_(#0 0"3_(#0 0"l3_n X#0 0"D3_W0#0 0P"3_@ 0TL2$$_002_]02_0xp2_r0h`2 _a0XP2_P0H@2^?0802x^.0( 2`^01H^010^0x1^0ph1^0`X1^0PH1^01^0xp1^00^[00p^J00X^e00@^T0`X0(^-0PH0^̾B }Y0X"*&:ܿ62.VRlNTJ@F(B>zvr`m8iea]O-\ M0p4`8P ЍO@`@  ^ ^ ] 0 00$00 ^0 0C?0H00 Ѝp@-\@p p@_ `P@p@E^ 0%R 'R & /  / $P /0 :i//0:i/(00/ 0oQnQ R: //fQfQ R:/0) :>0 //0 :,./0:,/0 :-./0:-/0) :[--/0 :-/0: /O-# p` s[8K @杉M Y@ 0S 00CS 6/@TswOM@Y 0S 00CSM@6/Y[ 0 :eR  ///0:/0@- P@4U00 M 0O0] Ѝ0T?0g 0\ @- ]T?0gp G-LbL\0M @P 2 8p] 0 S0 0  1] 0S 0 0pp0 1 ] 0 S `0p 0 x1pp`]\1 d]0SC4\ P1 0 q]  Q000 0b]Ѝ 0Q  ЍGV] 0P  N] h0P\  E] D0P8 h <]  0Q  @ЍG1]0gT?8TtG-p R 0`Rb  SM00@ 0 2] 0 S00 dX2 \ 0 S00 <,2 \ 2R    \0 0 1 1R    \00 1 Z_ R  t1  \1$  @1 R   T \H14  1 R    \1D  0 R    \0T  0 R    \0d  0 SP40xPs\t \0Ѝ0gT?8(h08`h8@-@ \M@-@ [J@-@ [J@- [0) p@-@ P[ `[:>`pp@-@P [U: .p@-@ [J$@-@ [J(p@-@ P[J  [  [ p@-@ [M@-@ [M@-@ |[J@-@ r[J@-@ h[J@-@ ^[J@-@ T[J@-@ J[@-@`J0 MPp? :[<<0<d` ^ 0 0z[ Ѝ0gT?@@- MP `p[ @[T \0Y[ Ѝ \|0 0tK[ Ѝ  H\D00D>[ ЍzH>$H~@ @ ЍT?0g \p@-@ ZP0kP okp \0 0[pT?0g@- @Z0dS0BS0S?mS0S @-@J@-@J@-@p@-M@ Z`Pj0P % 0 Ѝpj0P (0P$ 0ZT?0gO-鰐尀尠P jpP" 0 S 00Z@ 0 S 00ZT j@ `P[0gT?p@- @/ZPiP  $0 0p0iPpDP @- M@Zl0 00S T\PDSZЍ"&  0 0ЍHP T?0gA- P@Y pY0 `@YP  0Q  |ZSP P\L0 0DZ $\ 0 0ZHP T?0g hA- pPY1ƺ@P1 P0oS0mS 0lS`VJT>\nX>H[`P 0QJ \X΄ tY wYJ`0\>X ,\(0 0 `YHP T?0g@-0@oS t[PJ0?0fS nS0SJ0?0fS0SJ? p@-@PJR_ZP_ 0?p(@-@Z0:o.4@-@Z0:o<p@- P@Y`000 R L\H0 0<EYp$0 ⮟pHP T?0gD@- MP @pXh`P X/i0P! T`V+ `@ \0  Y Ѝ h\d0 0\Y Ѝ 8\4 ,X Ѝ.iT?0g`|p@-@ XP:-R \00Xp e`P  '0` 0p豾`P [ \0 0XpT?0gp@-@PJP 8V 0 S/ S  Xp0gT?(p@-@PJP 8V 0 S/ S  XpL0gT?(A-`RZpPpP@ D}VLW 0S $S  aXXd0gT?(@-@ WMC-PM p@WYp` WpF-VJ)V880 \0 )XЍT?0g4g @-*N W @-*N WG-pN.\PT `@T eYP \0 0Wp V@P VP > N0P@000 00W,0 (W0gT?(<DRT@-P M@W`D@VpSU 0 \,0 W Ѝ T?0ghG-0P qaQM 0@W 0R S00hW  0QB@}W  - 0 $$Q  S00lW !0D - 0$ Q  S00YW!01QW  0P  S00tBWl?WHw 0S00 DЍG2W0gT?Lt0A- MP@` pD0 `xW0S \0PX X WLW$ЍA6,0 ( ( VT?0gL4O-pRP @V`00 R1 L\H2 0<V 00S ᝷=SpW!L (@osKOV=pS00 S{WA RV=S L\H1 0@V%W` 9VP0 \0 0{V c#!(PP !Lj(@osKOCVP =Sp!L (@osKO,T=pSHP T?0g@\A-@TPUUU"P` -UpP @ET@  (U U<(T(0( (( V$0 V8 <tR p@-PCT@UTTPP TP 0`D @T dUpp808 88U40$ 0$U( T8 <tR p@-P3W@P00  0 `S L0VH  @UpV $U0J1p0gT?  0\ @- UT?0g\p@-P@`!W0P0p \0 0~UpT?0gC-鄀 M*N.l`Vp! PVPP@TU P t00 l0U ``0 T]S Ѝ 8\40 0 (CU Ѝ< 0gT?0S S/p@-0P @P "` l0p@"U P0 L L U<40     0U p@ ULC-@ 0M\Pp` ` 0`pT`0 JpT <0\8 p0$TЍ T?0gDp 0@-, (U  0 /||O  p@-`@ P`TP   \^XX \P00HTp (\(0 0 TpHP T?0g@-L@RP P:/ /0 kT <tR@-L@RP P:/ /0 PT <tRA- @S `S pS 0 PSt0@ P Ⱥ0P UDsX0  ! (T(0 w]<PHP 9p@- P@S`0P \P 0 00: P \00Sp x0Qt  pSp P0QL  LSpbvQ \0(0 SpT?0g\@-@yP  0N7@!@-@kP :N@p@-P`]@P DU@PMM @$@UP000pp@<Lp@-P`@@P lTdPMM @$@T `P 1S`p+Spp@<T0O- `4M\@$[P Z {P[Q 0  OS00S S 0S  : zZQ6Sx Q 0pS00 +S0S 0ZAS< 80S <0S \L#0-yP艟`43-QR0 - S30-0S 0\%S00R =Q 0|R$ RN7S 89P,)P R 0yS00'(R>> R #4QppR 8^(0\ 8 R090 x8R8S LxLR  |R 0 S00 \8 R 00 R0A  0C0 7 R8S 7Rp pR- 0V\ ' \PpL70 0 D7fR0O0O8 P7pUR7S vԆR  IR7S 6Rp p=R-( 0 hfhvR  `6  +R@9 p R#20`H 6pR fvR  5 H R@9  R`5` R D9P% S 5 Q hehuR  \5  Q @9R`` $5Q F9P$ S\\ 4 Q dtR  <4  Q @9R` 4`Q E9pPd$ S `4 Q49B ,d,tR  $4  Q 49R  0 0 3`Q4) 0PP#  S00 43 Q4) 0@ S000t3 qQ498+ 0S``@3 eQЍR`` 3|YQRR`2` PQ1tLQ QCQ 1R`0H2 7QЍ0(.Q1))QwLBO M7Rp 0Q+c#  c NI 4  QL0 S1W P0N hQc#  c N$4@ PL0 SXP17 P0M P $4$$Q% !0 0P24S p00& RO '^( 00 xpp00P24S L1tP0G <PP0F $P+O 0 S00 Ps0gT?|8\$Lt lLDp0h\8tx4Tt T( p\4:O-0M( R_ 9쉟쩟왟1 0 0@S 0 0 FP R 0S0 0 Q  0(P0N.l`Ty 0 S0 0 P@T. P>S R   O >Q  0O$.r 0xS0 0 O(.r 0TS0 0 O>S 0R   O,>S R   O- 0P' S0 0 O. 0P' S0 0 O$ 0S0 0 O 0S0 0 O>0 S .0A ?@DO4'40 OT  O R   }O?Sl|&? R d0cR   & kO-=)R  Q  ]O/R 0pS0 0 SO/R 0LS0 0 IO8f8v@@ T ?34 NP M 0S0 0@ /O T?S9?S ? SR   O 0NS0 0  O 0 S0 0d O 0 S0 0H OO<nPP 0 S0 0 N/r 0S0 0 N=S R   N 0/S0 0 N 0/S0 0 N 0/S0 0| N 0 S0 0` N T N?S S 4R   N @R  ? N 0R    N ?R    N ?R    N R  Pt3 0 h {N \R   tN  KO` x-|MpWh TR 0 S0 0Z a[N R 0S0 0 QN 0 S0 0 IN 0 S0 0 AN 0 S0 0x 9N 0hPd" S0 0T -N 0 S0 08 %N P0Q  0 N Lx@T T0!N 0(!S0 0 N I F0 0 (0R  NЍsLL 0S0 0 MD M)Sv[Pt|HP LHT?0gz L4l844LThx 4L\p ,LXpx$ Kd(LP!00d$ S0! 0  Qh()  , ,Q(  P0$0M4 dK0h0 r$ (0K0 R  H0L,hD(0 (0HP T?0g8ph4G-PQp@ {L200 R) \2 0Lp00S ᅭj=PS@ ? k=@T00 SkU`d BL:=S \1 0LU`[ )LP \\X1 0TkLU  LP & \1 0WL0 #<{ Pџ0 P@M@] TP 0S 00CS8/0#<01!8/Z=S@ᾲ =@T GHP 0gT?`x9 09 03G-pRP @K딁00 R, \|1 0pKT00Sp Ḭ=`S @ r@@0=Tp00SᜬW` sK:=S \0 0KFP z=S@8@@=THP T?0g@O-@P 0<TK8QKB$KK5  @KP 0 S009KtT   0Q $K=  B\-C(С=@K Q/?K 0t/S00J 0/S00J j 0 S0000J 0S00P# JA DR  @>X JT 0@S00 J\>Sh/R P20J-]Y+ U$ 倢 0*Sq 0 0 JW  0J R J |R  JP U U0P"PP|J qБR<  PxJPU nKP iJH 0S 00P \JUZD ,q,QR  OJ넱 ㌡們0p4PpP:5PUR 0P H 7J-4<ЍOH -J H 040 S 0   J XP 0S00 JT 0P   JT?0g$PHP h,d@S GR 0zdA-pRP`00S@ ᬪ@B00S @{IX000 R D\@0 04Iኪ!HP T?0gp@-P`JP GHpdp@-P`JP GqHpdA-`@ZpP @G`H 0S S  uId0gT?(A-pP`X@P sY@P  D\@0 04XI \0 0NIT?0g@dO- M& 0  &PHE  % 0 %ueH50  0% H0050 0%,Hl50 0%4H00P500\%TH 50 0<%\H005$%00|HH~H|HGzHQxH[vHetHTrH|pHoG!HHH&&H&H+&H&H&H&H5&H&H:&H&H?&HA&H&HF&HI&H&H&HK&HN&H&HS&HU&H&HZ&H]&H_&Hb&H&Hg&Hi&H&Hn&Hq&Hs&Hv&H&|H{&yH}&uH&rH&nH&kH,&hH&eH&aH&^H# nF (VH%(RH (NH(JH (FH(BH  &>HNF)G*&4HEF '-H ')H'%H '!H'H/ 'H'H H1 H  HH HG  GG G6 F$G$GE ЍOcrPiG) T?88 4P<&( PB B  p20?2c/\ 2S \0325/ @-0@* BH@FQ/ // /0 S@0#/O-QMp`E@0: zHFXu0 S*@PU, @U' 0S0 R E0P" R 0H0P "0 0x"GfG00 0ЍH"( F@P 0Sr2 R' HPIG0  F0 0@$@0Ѝ0!0 0 1|!F0p00\1PoF<1 R= JHP 0!00 @0!F0: GHF R( .HP  0 00 F0: G+F\0X1FxdD@D0,&F0,0 F B Lh(C-PM`@p뜂X`EP5@ 0 0A0 B!1 !0@ (0"(D!(NE(ሑ@Pl !0 0R2 GP#Q 0 E#p$`0@@ЍT1@T? G P0 010,!,1"F 0 !00 0F0E0 R" GP0: -GE 0 0p0X ED0 D<E 0004,0|E hB 8B30A-SP`@< SG F FHGEGVK @G R  1)g0S3G0S-G*G'G0S!GG QAGGG` 0V pPSG FG F ADF 0  ESdRG-M0  à@Œ!  `` 4pDXP 0Z0`   D P E0B10`b0 +CW 0 ` P0RЍC0p@-S@P F 8F0Sp@FF0S F %F p@ F0p@-S@P ~F F F0Sp@oFmF0S gF E p@EO-@lMp`PJA00x=H+0x= Z ZC00Sa aZB:,:u뛡"R70:}WO 0P`P000 000UY-=R]\cA]R͔-`0B=Եd0u 0 ` 0`0 +,C lЍ9 R> EP )0  09)XDꂑ0 R D|-hh  P0|-@$` Z T H   p RW0@0 00Q0C?o20SD \ [*0P00S p8(0 R EPX0,0 <0\00<<00=00>0-T0R  ? -@ P-A `` c 400 bB$ `  40R   R  """,  R   R00##(#<  0, 0S 00S0 0##(#<  00 0S 00S00##(#< 0+ M   0 DL0D  H W 00$,P` 1S  D C  0X(0 0  W,0PpTpXp\p`pdp-P /P -Q 0 pR00 ` |zA( 0 0CR0 DP  D00$%458CW@$0G0P`W    P  B#0S  $A h0q?A lЍW``PP4`V(0 r R }DP<0X 00<<00=0=T`S00>0=?0P=@0000 0,0A00, 0 32" 0 0S 00S00##(#< 00S 00S00##(#<  0`0V 0 `0  MB00`C F! `f  +WAH`D0DL0tWI 0 0WK R DPoPT0` `0WX0 W0  0X`\  0 000` \`0!0 0!1]BR0j 001A1pAC\0 0  0\RD CP6P0 000`000 0A 0 0 0B00`? B0hA 0TA|x00`p08 AT0TAB x <L: 00@- MR@P VCP P 0 0D D0A jA Ѝ00 ]AB tE  /*@-YA-P`*h p@@P 0/p` P000S(P RKB00O D`G- qMP`⧯0 V@  ? 0@ BV  ` V0S 0 R BP00ЍX 0 0H0H VA00Ѝ(0((@00Ѝ B PQ00Co//3P MP ZP gPM/P &P P / /@/@P&/g/Z/3//@-@a@P AP `P/A@!0 0 Pp@0 ?$Ѝh0 E0 \ 00Sp|0f#h #3 p0ES`P@@ p @$0$ ]?ONB &O-Po* 00 `@Q ㊰P00 @ 0 Pt0tTz>k`P@00P @ 0 l>E$B RLON@DaO-\MvP :@T 4@P3 ` Pp0V C0 #@ * R @P@0S d: RA @PV! @0@!-D P8@P@0@4@<@L@H@0T&@Da <<H HLL 004 4Q0@VP  Sw WPP88 @TD9 R ?P 8w R ?P? W:n@0Spl 3n0`@80XP?=.P 4 ZXH  #n@<0SJ?000ml0<08 R^ ~?P8<< <p7=΋ ?RP `?P0 0R0'00\Ѝ0P70S p 4]n40YnP<Hm<LPn0h<00l080m0@0?)  ` P 10F00#R V 1==p0@P@Qa  @PXαQ R  \0?&=`@Ҁ&00%5 s=`@%0  0%5e=R: >P'Z.d50SK >P% ` `5 0 L5(%E=3(% ``00  04$/=LP`$08  0$4=4d 20,@(P` tD G400$ 0 .> $<`,$0  0`4#>000@P8`P`0`4`@`<`L`H`0S 0S p3:S p`0@0`X1@;(1 R4 =P `X!0 0p @1 6<`$!0< 0 1 '<<`000;0q0` `+<`0p0<;`0  080 4;B '$DR8YjtQDxg$9`p@-@P&p@@-@ /:J030G-SM < P BRJ 0刈00m0Sp0P<   BP000W 0S z;?=.  p0Q, 0B,CZ 0@7 @9DyWpDy 3 R =P0 00j Ѝp # WD`30S <P ` <3 0p,3,#]; E49 8 0 @49 10""SC S05 59ĕR 05)P " R <P 5t"Q`l2l0 0 T2@"!;#  !   # ͓  RG RD RA R 6R<m0Sp;0S08 0C50@C0@@:?=.  pqP, 0B,B0@By` 1 0p1 :GZE  @ B#20S C @!SDQ&20 :`00x0`E:&`00 @0@@=:<4S`0 0 ( 01:B ]|_LUURO-鬑@ MR`pT ;PD0S. ttP@0@SP$0S ;P 00000 000@d0 X:0 00000@ 0 d 90S$ ;P 0 0e0 9:Ѝt 0  0@^0P +:00@80^(9 e0ЍO9B h`T?@A-M\Pp` 0S0R R+ 0 S:P1@T? w;0P$V0 Q 0S0 R 0SP:0@T. \;P00Ѝ000Ѝ0@@0 90x0@H@0` 90D0 8Q900$0` G90B `Rp@-PM`2S X" R ;P3Ѝp(2 Rz ;P 2)"090 @R0@ S0DS1 Rb :P 19!0b90p!2 0P!W9ЍpUT UT UT 00@0Q0  RT 0T?000#200 1<0"300T#1000 200"2 000 00LP08~4P(08w00 8pB ` $42@o/0p@-S8`8` [@  $8& 8J024p0 G- Mp[7Ⴇ`Q@(0  980#< AQڶ3ᦁ ` 0P@3< 0B Q `pP@`p00 G9 Ѝ D0CD B8xT@-R0 0RM@`a  :P-P PUb :P4Ѝjz='R;: PRWZ 9P ` l1 0PV0\!g807Ѝ:*'=`0C 0 L0 O8`@ 00 P0 A8ЍZD-7 07Ѝ@8:=`0C XX0L7`@@ <0P(7`00V 0 7B `<hO- c$Mp@WP C 9P,%U 0 08P z⁗Y? RV j9P `"0 0p"v07$ЍZ7S07$Ѝ`py"0 0pPe0! 7`y00 P 1eN78 8' dၷ<0P R< 9P  507`00v010-7` (1 00 !7W儇0밷 0R& 080PD- 0G77`00t0h6`D͚d 0  08 T7D`00$0 6B `LȄ0@- QM @R0 8P;P R* 8P Ѝ0@Ѝ0` 0 0 07`h 0 0P 0 7`00(0(6`000 6B `0@-QM @R3 k8P: '?;P R* [8P rЍ0@-` 0 0 06`h 0 0P 06`00(0(Q6`000 J6B `00@- MR@ 8P `h 0 0X 06 5: 'Ѝ@p-`00 0 6B h`A-j7MS $qP @R+ 7P ]5U၇Ѝ:P R' 7P ЍA` 0 0| 0I6`00T0T5` H0 000 76`000 5B ` 07/p@-J\Qp0S 40\9p00PVP0\9p\9@6 Z$ 375\ 4 P@-Mm P@o P` PWh؏ HĐĐ 00ЍR R0=C<1!5R0 Y?!5R0=C<[?!5R0=C<1t!t5R?0 Z?T!\T5`1@TB +70P w81@h@,1!501pW! 7P0 50 5> 5w0h@c?h  y5w @` |0c4 5w@0` 8 40xyRB _RR<p@-a@TP0LVM 0,4P`P e3`PЍp8tp@-P@ P  6h U>XUh l P5T5p蠎0 0R0@-04M@PT R. R  44Ѝ0:$8-4= $ (0,0\1 R/ v6P;` 0  I4 2 6( k4:,-0<=,0:@9 $ ( ,0( 0,00 ( R$P`0 0 l0hY4:(- P,0`< 00  00 4(B 0P : L')Z@-A? 4R63d5p@-\Ő@M R#22c0BS ^0`@T 5P ` l0 0P\0\ l4."d5VЍp`00$0 3ꉈB 0S/!A-`MVP@X 5P@UP; :UZ-:\9S1 M @&30 <d5 ЍA}4Z.5H `2P 2X HiPi28 Xi28i2g>;I\9S 2\ 20\9Ѝ``2pt2p 00d I?3<`p2(2 0I|3B l)  0 RQ   /0@- @R R  01S   Q   \0A-SM@`1 \e\x0\0U^/230PX5( 8A20SЍSPz0 Sg崇 PЍA6L0S X^ 0S0S 0@T 4P u000| O3|P 07ЍAY=P su 02 B $ *"4S00@- MRP@ 4PЍ0g̓0"4/`0L(HH02`8 0 0 P0 3Ѝ0B \ C-0Z"t0WM@P 0G0g=0`f0$ sS0"4zcJ>N Q (PB RB PA0P(@0 R* F4P ` 0 0p < 2>>Ⲁ#DЍP P P0P@ X0P TT2`00 p,0(32@B  R0!S AS S ///@-uPO-\PIMU@ T5 R 3PqPIߍ$5`  5%\2qPIߍ :p`z.ăP\ . 40P( R| 3Pkជ0\0L?00d4 ⎇ R ! !   ("( PP 0 Sv Y 3P h`/30P3# 2$q -P 00S r3Py(q  $P 0X a3P.0,#A$30\``@幘 ß0  000e` 2 0 P2"1`02V1`00xp2tO1qPJP3(~c/t2h2@" 10 Rv 3P `("0 0!?10` 1 /x\d0\0U^010PX5LP3$)/10P1X! k1vh`P/P 414 0$2$/01 ,0_2(~/p 00d0 R 2P ` 0 00x 410`  0/wjP`00X0,0`00TL00B Fnh!_\"d"!a!6"4"!1!R0,0 #3`<3,0)# !J,  Ġ,  Ġ R  R $0!,$0`VM_0]-Z z`V  -PZP Uo pWagb 0 0E 0S $ 8  0$0Sqg!r(sY㇏ p $0SP 0H 9RD 0  R  -PH0S0 S   -P 00I0 0J 0 |$ 0t$0 ,Ւp +$`D*0<$ 0p `0$ +P U0 00CS#013,ЍO᱒ [+$p*p 3v+n0X ",-./L 0 4 8<2##(0#<  0 0S 0S 0S 0 4 8<0 #0 R##<  0  -P 20p2|" +S  -PB *0 X" 04"0 +6`VX  ,P = "0  0^?! i+ns R0$ %0000$ 1t*'!0 0X!|1 K+Pl!0 00!G? A+c00 0 ! 0 0 0+0*00G*H 00 0^*00I00J00 X0T*:0 T04*808 *" ,ЍB HP O &$ t&t$&& &&% &@- M`p+PU 0 R  Z,P* Ѝ 0 0 0 *0b* 0@a((x],\0 R  2,PH00P@0(  *$0$ >*B '$zPLH'PP0@- MQMh ؽ$1  A0<P P 0P P P P+ Ѝ00!@  P4 0(  0$"$! l$"$!L0  D@, R ,0,@1 E/O HP R\A-P`@pP @P@ )A/ C-`MPP@p8+  +P0P( @0UPPP' $Ġ@ $$L p  @    ЍCL 00@ @0 ) 0 ) ЍB p'$O-`4M0@ 0X00\0(0T6P`p$0帶M  C+P2 0:0PV @@  $ %P%(Ġ%\嬀P +*)$W岰崠嶐 p4ЍO>( 03)0 01(@) 0 0@ |0|  |) T010(,0),0000 $0$ ) 4ЍB t$'$C-`p/ 't&@Ѝr)0 S j&@00@?F ^'N(@`)`Tpc TK @TtP/> R  ))P@B&ЍpT T_Pjd> R  )P HH.0  0p0> . '@PU= R  (P 00=-p  - l'PH= R  (P |=-0p@ p=P<= Rr  (P 08-0p  =< R  (P 0,0<, .'P <P h@v<P4 T|@T  (Pk0AS[| D%@Pn 80#<AQ(ڶ3 03<  & 04 880Su  }'PS 0\(0 ?70S  l'PB 0(0 87 Re  ['P1 0'0 7R^  L'P"  70 @?70S=  <'P 0X'0 T7 P 7 0  0 6@%C 7 @1Dᰐ &&0 0 @6<& %z0 RM @TD (K@d6 嬐1ᰠ% 464 %U%!L(@@0PQ`V6  &P qg5050% @J%0000TL5@$ '\ P pW  &P  4R D@3053xy$@330X3Ln$@(D0CD B$303X$@T30=2M$@ R  (&P L#0 0"<3 $@20t\2P/$@ @*#@00 2 $@00 p2x$@00XL2$@00,2$@f <2<@#0 $( ,0A4o%@@p|1|#@00(1#@ (1R$A@If@ X1X@#0#@z?f 1 @h#p000L#@h00 0(#@_0#@YB ($p, )\,X)+,HP )8**+((++,+p)t$)l*,**xT)O-p$MPPT0dL@P0X+  <%P"40P) @0%$$(&ĠP @P$L`P  @$ЍOGT 0d0@?@  # @`0)# $ЍB -$|0##1@0SQ /@-@R0P @0$Ġ$$,@ @ ON0A-pPSP% @0 %%!Lj %,P(@o P  sKOTP $0S,0SfP=30c0A p@-0MS@ D! R>  $P*Ѝp10<`V P``P9 @P  "Ѝp@0@T#  $P 00 `? "| 0 0d h0 "Ѝp0@@0@"( 0 z" B HP P-$0-m 0 0Rp@-@MP(`$  E$P=0P$ @0$Ġ$$,P@ Ѝp@[p0p 10 0 @T0T  "40100( 0$7" ЍpB HP t$-$A-Pp`P @@%%(%< P0 "pA @-RM`p!g!@P? >#P@ #   ! !" 9 P20 <@\"X1@T  #PЍ@ (1 0 `@=! -"Ѝ0 ="0 8" 0H0 !0PU  #P # 0D0l 0 "h#` H0H$!HP --мB .$-R--@-8@0<0S  "0<>0 < HP м00<P//HP @-M` @PN 1@ <00R@<0=  -#P,8p#<0L@S9ڶ3PL  ! Ra  P 0!448P#8& < | B B0? `!tЍpC B!!:A S*:0AA AAp :0@-PM@XP 0`pW CPЍ@ჀX 0 0` P0@ t` 0 AB 32O-XsMPZ@@`y PRX0 0000CU 0S P!rЍ gVP_0U" U<0Sw P $ D2 0`E?0"Q0`0`ЍPEP]Ѝ!X10 0 P 0!,R0BPE0P;ЍP!XH10 0P 41zPР Ѝ0 0 J00 P0 !Ѝ00 l0Ed{ 00 00 0C0P ,0f!OB X423834 :E0p@-SM@1 S*1PUc 0,*P 0,P`_!0D0|!0 0` :0 @!Ѝp0$!(( 1PU& 0,P 0,P`/ 0D0 0 i0 :0  Ѝp`` \0@w`` 0 B 6 64LR50-R M:  0 Ѝ 6p@-Pj M-\PTp?@T ]Tp1PTpQ/C-:=-̌\MP 0QP\ 1`p@W1 0,vPU Ѝ0,p~ 0 0 P0 U0| :0 \ OЍ~ P 0 TB P6 640C-*M-\PT M ``pj@T 0S \  0@T ЍXQ/O-PMJ=-\PUp 0U Q0QpU<1`Y8 0,PWMU @U0 ~:0  Ѝ0,y ~ 0 0 pv0d  :W a} p 0vB 64|6p@-`QM Ѝp@@,!h1P  q:=-^  0\ SR*1@T3 0,wP 0K :0  nЍp0,@` 0D0 J0 0`D :0 D M`` 0JW 6B 46@-@a,1M PJ 0  Q 0 :0 ` Ѝ0@T 0,P 0,@pDp00p 0 } p1p 0 64B 6 0/C-Z@Mp`W 1pWV 0,P 0,pxX!00L!L1 ?V0 0Ѝ! `Y 0" 0,P 0,PT00`p0   000rЍ9PP ` X0XD) 0 B \7 67 0 H!0 :RC-PM`@2 T% 0,TP 0,p| 00` p0 00 0Ѝ/P ppTp ^e| ` 0 1B 7 67@-Zĕ$M| 9:! 0C"*0C2c3# #2P031BT 0p `R P$Ѝ`ĕ 0 0p @0\ S$Ѝ`00 @ 0cbp)OǸB 99C-z0$MQP` ,2@TF PP$Ѝ y1@TZ P ?=4!@0  `@1!=Y!0RX1@TD tP @!410 `@ 1  10 `1 u0!00@ `@ $Ѝ=l 40 @\0 XTQ 10 `,0 (B|B D:U 9:] :I 0A-0M@ pPǚP :7S ЍZX>Sj̇X(2 RW P ` 2 01!qW q RV P,WPEUW RS PЍAS\!P SPRG P#W` 01 0P$1!97`C 0 0 )`000`'0 0Pp0 `0H0h0hT`00H@08`00P ,0,B :,9L;8;3;EA-@Mp`TLQ\ZP 7 je `7S07Ѝ T07ЍZ70 0?07Ѝ@-0 LUUR@-F0 9;R O-:⸏,MX/ 0@DT`C 3T( T^#pp` ! (WPu 0#4Y \? 80000 \G 0/RtP00 0 @R0Uرc 00 01000h1000c 0 0000000 $ 00 $PP030# 0ONO 8;x8 0p@-4@P  H1  04p@1P ! (UP  04#20B&S S   0SS  QQ   Q @R S S 80   @R    `P$|VV 3 #LP ON U@-4MpP`, @Ġ `P@ 4Ѝ@-jL74MS4ЍPp@rP@0 R  R ? 5R0 000M70Ġ@0p  000@Y\0p@-SJ J P7 Zn i7S07p ^@-0M0 @D@PЍC-P4M @`P :7S 4ЍVR V V2 T2T"TT1S .  S`, 0c(p/0. 2@T\ P?2ͅS 0C4?0 04Ѝ1S $ S0c(p!`/0"`00@SL.0@0.0"0(p"#0"/0`0 .00.0`@h"/0 0 0 0@?  .`P2/02 0 P0( x&P9LR;B ;;;0@-^Mp0 B 0000%1S0000S( S R 80@ P@BTP0B@0PB3@ Ѝ00S3 S81h@S20ABSS00 0 Ѝ00h@S20A40C?o2S000$ R :R 0S 0 00 0S`0  p@h0TB@A4TQ00H0H HH#<AD@D B0C ON9Rh0@-(1 N0SM 0R0 0h@00%1S0000S20A4S000R 0 pЍ000 00 80@ P@BT 0B@0PB3@ XЍ0#<AD@D B0C OONhC-H0`p0#_ 3`V P@ 8J P 30P@3t# *wL3`V~ P2 80 ` @30`43 # "*@9EyE,W 2 R }P `"0 0"2 $0SFl20St fPNFPp T100P4S0#E9%*) 0  70WE910SL 3P ` 1 0p1t! 8 }  P1T(3 8`P $ L1P @1  8 @b @0    8`P P0$ x `00 0X p`00ph0< i8n  0$ B ON<9<LUUR<|=x8P== P@-M P <80#@@L+\<@@ ڶ3,0<@3Ѝ<0< <<1 ,D0CD B& =*LUtRxTO-PpWM$  @P ,`V  pP0S~ 0 S N7S7 U PP; @80X%A B+PX%  3 ,`A,0\3@``} 0SF , | $0Z Pp P 4PW Wߍ\P U PP0SK P h`Pn0 0S0Sx S0S S}0 0p0@N7S\P d PX50CX5pWp @W pPh+ 0< S 80Z AQ03+0Q3< @ 80< AU|ʶ#40S < 嶳  @ 0P 4P ,  $0PZ p` PI e P. L/0Sp0Y0%0QU 09PG0S)`U>PP @0N'R\P  `P X0 AX@9M [@hP19P x D xdP 80#<AwQ`ڴ8 3Rx0x < 3x hx ) , ; $0PZ p P  P `@ 80@P8$``{ (0D0'7 ^ k$`@m 707@P 'P R !RW P: 6:P@R 0l4Q <  B R0! -0  0$4 $``= 7`0'P7Ph`   6h20G40C?o2S04U R> 4S4S040S7}H6PU w PE $ P D60P@46&  5$`  5x $`@ @ 5m #<A,D0CD B R8 : P `0$0 0\%0 L5$%  U 0 R* Q <00CS8 8P4$ h0G4QW00s$ `  4\ 70S1S 0 @7pW50Sq ,0S]Q> <0CX Pl $$``h ` 3Ph`  l4Sy 4.Sv$0R4qPPm 80< $AQ303<- `h`PU0 # 6 $/ @@ 2 ^<`0l4 Ph`i4 2l" G7Hh 0d8KD P :PD`@@ 1{ *$2!  xD0CD B  7AQPڶ30<3 E7 P 0&8<`@(10@Pp1 !  X1!,, 62<`@@ 01 1  "D0CD L  :m7|D0CD L DD @0Ch B ONx8$>~=9 8>=hp>RRLUULX>xT8'>,p@-`M@PP0: P  P0PU: 0S @PgMPЍpv> LQ @-H-9/0 00:X>7/ L7S /0S0M'R/O-P/0 4SM@ P` /S& ,S- /S| ? RE a P40 0D?jO@qЍ+BS ,S S% @TЍ@04⼞0002p [ ( P09:4.$0$? A#:@0BD.S@>LSP.D>QH0LH>U 3+S@0, ö#0-<0Œg'0!|,0(p P0K0P 0k0 S/ 8 5  0P(0$ (0z89S 0S  P8 .08900@Sw (D)2R00%1 0S H9S $L-L‚͟"* AR H)*P9S $TP-L‚H͟"* AR P) @tP3@)L0@  H)R P)R 0 0T9 0P   S$e 8#<AQڶ# #< @00 ([00(0 "0P @ R  'rPU| N P5@4 C M:pP* ZU 4 P^p;#h+#:A0:`@ `F V{3@0C8#8 Q3@ 6  \ S Q< P @ 1 0S S S 9*|t Q  <디@pW W l9P Z Pto0S{0 x .@vpZ P00S S_(P 94 #20@&S SppcpW P G)0  08)80 2  C3 ` `P1)X X 0:`pP|  @47 R gP  7@ 0@7P(`'pP   0pP: V @6 R 8P  87@ 0@?'0S45S80#4B <@:8X ,B A AFu ?.?K=i@X?C ,C x8@m@B RA B cbp)@px?)<xTB9ONA`V >P^@ 10p1T ^@  0000 \1\<Pp1p6 1-N@Th  @P @ bX10\1@p L0980# @$+`5$0S= S0S# 3@ N7S  @0 S@`嶃P 01@04$T+ X- `D 00 464 `@7 00@ `6`(0` , ^ , d6 t6(& ?@T @P] G@ @(@6  7& &Lp7@E070@>1 pR 0S 0 : 7pW P %'0  07\'2  C3 (000 $8$q80#< AQڶ3 0< 380E)R@0070@9( P 30 F9S  R   0- 0P0F9X9S #  X) S @ 0;07S0 S 0 @S (00S(0000%1S80#<AQSڶ3 0< 3 (0`0,0,00 9 ih㙦b `I4V Y00 p)`0 ?)O1s20 X:X .h:(*hp W `Vd3D0CD B B7` `:  @`V Pj49:40C,<+, CPXY% xP. 4ujX/  )*B 崻崫崛 Q0 Q0 Q00 B\ Q#:BN2020N@CC^T0-0CS00 : "=S 14B2Q-<MZ P@ T 0SH0SP ps{<s[W_ 0= Q0S# 0V W<⶞&'P 捈 X?h`St=0`p= @pFp= @ 0 D0D B0L l0 0SH0   p`00,>,"0.00 0@/P@=X` >10A0.0 @/P@ 0F)R R  0 0Pt0F9P0S @JPL0M(] P_](0 5 '0 y X) @.PL0@ -0t0X & 0`  \ <0 0C0  t6t&80#<AQڶ3( 0 < 53 B R P 0`50p=% 80#<AQYڶ3 0< 3 2 0 ` \ < 0A H@5DH0L  Y505%VDf` -`4 o0$[4$Vb00 4d?R H4H4I 00 H4H@@3S.n4@$0SE :S/@;V3@ z'4#0 0 3l#. 4ncP10  h3h^@xT3#P 040 3e <#4Y 0`p p x2hM&( `"0 2<"(0`00l290S2 P @20P=!Y( `"0 2!~(0`00|1v 00L9 0H f1D!\y 11 !x$r80@$ @"Q ڶ3@03@ @Af`#` 1@d#<AD0CD BFe`` 0@ G0 (3@9@>n=iLUURu>C >?vB : (A}l@TAAL x?)hF, BO-`$M50V5@H弄u0\P8  ] P @``H(!0D0!0 @ 80 B+Q+ڶ3,B,03@ 0R @0@PP4@B AB岁BqB@B PB,0($$ЍO`0@000 P0H8#<A,DD B0C B lC9hG-8M`,pX`P1@TC P6 4U@ 0  0 =#=0pP8Ѝ,p0 P   0 0 0 J80#<L\3 03<  \,H0P  00 <0<8DP0CD B3B C& 9xTG-P M@DJ p1XG:N7S  & Ѝ0 [*P ?:P8pG `P 0S;  W`80#<A QH3 0< 3 q.+PE#@0@,0, B(#0 $@0,  Ѝ B1! 7 Ѝ< 0p ,P:80#<L Pʶ3<D0CD B, 00 R P| < p0 ` p 0d f cS<9 <!< `pT 00H H0 ` 0 EB D9 C-LM@P0S` ΁pP1PUS P( `@iX10@pL1L! $1pW* P, )0UPP,P0`$0 0LЍ0Up`p: 00 p0 Rx0Up`' X0X@`@@ 0B E 9 EEPE *-0/0C#N^𝴾- ASoS00 䮋s0c00 䧋0A-PP  @᠀p`@ p'U0 @@ 0S S <0P0$00@ EEEC-PpS㄃WM`h @a0S`3@Tv @PF/00 +qЍ 0X ?0 0R00Rgq! GT:0S7 0000a0@@DOo0B20 0Wx2@] Tp PGT0 0Ѝ 8a"0 0 t0"k00001@T< P 8m10 pl0!P8`a00 d1t\0L!PPV8OD!0 0p 0!0T, P i85 0lX8+p 08 0 0p 0\ 8p D0$ 7EEB F4FEFpFRFFRO-MM@dd,@XSMpP` H3 R OP4Ѝ#d(P 0X +w R 䲟  a @V2`Vu ,PMXZ```XT"0 0 `08"Ѝ0S S00 P P:/0SB1PUO P  t!a00L!0 P @xz0,!00!0 =a00 0 0 @0 NN t0LX008`(097EEB $GEFEGGG8GGEpGO-M`Bp4B@T]],PP08Ѝ@"T8Z U0  1  Ÿ B !0 RC 0=0P !0 B?! ;`0 Ѝ rH1Z0* S    P 1 0 1  0B0 0 S P t 0 0 F?\ ^ 00 F40$ꡠEE B EGEGH@-@ ,/ @+00@-S0 @0 @20S?C ,20`0d000Q0p@-Pm@ $: (0JpO-@ptM `C_P Z7StЍ00CST`x߽✠0S 8C8L08S p0 H0R  PP8S0C8'008 [70 <D  7(`0HP T0\XLHƟ?.,\N1cX PLn8T C8 ȠLȠ(000 ,@ p $0% PU  aP `@50|% `0` X0PT\L ş?.,N1c\LnTP8X C8N$ 0 p` (4>7T0H0SS3\0cT0Ql\0 00p@-Pm@  Z  J019pO-J8TMS@ pp PR  P jD%0Q<ş8%#0,0 0` ş?? 0  P$4 ,j4`S8`&b?S` 8S ,9S0C,9TЍ(00 Q ,9D:8 S09xp1WpWB Y  vP- 0  $`0 WPPH01D @H00 PS@0D $ ( ,`p3p#084( 0yTЍ09xpCWpW1Y  3P ` D 0Y1y }z@wD @0 (020, 0p P($`m?t" uj0P88#0,Ÿ00??0`00 1@  ,K  $&@([3#[Qx09p pC kRpaWp\WP` LH D0@P  H @0L 0D00P($` p 0,0 RD`P @8@ D $0 P `p(H0 m B lhth@DHKHzHHDLKA- P@U &2  P0 p`  5EPP00*0:0J0$pTp%` p&6F'7DG(8H) 9 I +;K4PU``Z0j0z00VWXY [ePfghi kt vwxy {dpu`0p@-P@ @D T ꀙ@@@X@@@D@D@@p0p@x0p@]TP@T @@p80 90 @B MDP O MMO- 4M`PQ*J0㔪00 匚匊(pK } @/l,1 004 M0 *0000(0  0p8p tP$ĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚĚܝĚ̝ĚĚĚĚĚĚĚĚĚĚĚĚlĚĚX0ĚĚĚĚĚĚĚĚ̜7p 0v7q7 [77 d700 7ZU`7 080 T7<80LH,7,'IB'7 =@6k46  060 01C11000 '6 0S S S |6|&00x6D6 0P5,f@V 04@N0S@W(&Pl {RP` 䅟0s (0  PHSP> oP1P& z=-Q *!R 0SQ ?S P% R [P0,:z z?S $ R BPpz/410:P  4 6P0:-PTH<0 $ aP0S: @T!h0S K38 38 P UX`30P#43 x@ 83 Ph `0T3 # 50: 0}0(gPGPf0S<0S@Ӿ!0Sڷ0": / "0 0"2(c0":? 00 0h"p2: 0?0@424I $(2(*P S0 "tG0 y0 r0 k0$ td0$ \] HW0 0P[@(Pm 0 D0 =0, 6MDP p8 L NNB B RB B 9 XQO Q$NxB 4QRHP B DTy) ܘt P<QB RTPT=mScUSTTTTTStS`S4SSR@0S  P R 0S//9 p@-|@0S0S  Q`pPD PE0 P  @0`p9 V`1O-@MTP`< P@` T V ` `IpMTP0U  4w\0 q@ TЍ@0  Mp 00l <0Tp0P  5@0 $0<zB .0|   Ѝp0=0Ѝp@/.Ѝp@,0( (( * 0SRA@-PM`@Qu4<<,<<<<<0H R * 0S!0  Ѝ 0 ?o2<0Ѝ@1L1`VB 0,P 0,`_p!00 u0 &<0S 0 Ѝ@ 0=0-0   UЍ0=0Ѝ@-Ѝ@+0< DD%pp 0uB R@-@(P (0P ,000 0< =  @&,tQ0@-P M Q Ѝ0@+V0 @10H R 0Sh    Ѝ0 * 0Q,    Ѝ0 0SRQ Q- M 0D   Ѝ0   0+LRQ- M Q Q 0 x 0  Ѝ00HQ @0 Ѝ 0SR/0 +0%0 0+0$0%0 0+ 0$ %  +p@-@A=DM` 0CQ1P$0%0Ѝp@,0P%0,0   PЍp$ R  Ѝp@  ?o2$0Ѝp@00 Rp@-@PA DM` @Q/\40%0Ѝp@m,0%0f,0u    Ѝp$0S  Ѝp@ 0 V ?o2$0Ѝp@f0|0 RQ Q- M 0@   Ѝ0  0*LRQ0@-@ MPJDD0t;LQ 0MT    Ѝ00 K0 Ѝ0P0 yR/0 *0%0 0*0$0%0 0* 0$ %  *@- M@p[HXP306`  T0` 0` Ѝ @-P@ M`p:HDQ/pH 0%0 Ѝ@+0%0+0   G Ѝ$0S  Ѝ@0 ?o2$0 Ѝ@/0  R@-P@ M`pGDQ/X0%0 Ѝ@d+0%0]+0    Ѝ$0S   Ѝ@0 M?o2$0 Ѝ@]/0  RQp@-@M` Q PN0X   Ѝp00 00 0)Ѝp@4 LRQp@-@MP`0/%GQ 0\T   Ѝp0 Z0 Ѝp_0 a R/0 )0%0 0)0$0%0 0) 0$ %  ~)@-P@ M`(p@GDQ/X00%0 Ѝ@*0%0*0   M Ѝ$0S  Ѝ@0 ?o2$0 Ѝ@.0 pR@-P@ M`(pFDQ/h@0%0 Ѝ@j*0%0c*0t    Ѝ$0S   Ѝ@0 S?o2$0 Ѝ@c.{0 pRQ Q- M 0@   Ѝ0  0(pLRQ0@-P M@B.(0 Q 0LT    Ѝ00 J0 Ѝ0O0 wpRC-P M0 (MD`Z @ ]⸐psK0 OT ЍC-P`@ M8`9`0 (T ЍM@pZ @ ]csK0 OT ЍAC-P$M`@ Q񟗖$h$PP@P`P``0 ?o280-00ST :1P`p@orV00SF20Sx 0,^P' 0,\"\2V``WFDR8902Q44" \,Ÿ0 0 P` 0"$Ѝ80S-  $ЍC}090?)00S80S 90S%l10SO 0,P 0,4aE Q090$ЍC)$ЍCt'0! 0  p"V0 XP89p0^tt  \0! 0pX0 P,P0qp PB 8R@-@,P ,Z0,0 08 9  @x'(Q Q- M 0D   \ Ѝ0  % 0\'LR Q- M  1  00P = Ѝ0 R@-@M Q$$$$$$     ,BD 0  ЍЍ@&S0 RO-z M4@PMP `Y  PY),!`PE  8[Z80S 010!PU) P=-`= 00m=-Ѝ0  0\ 0 0P E0b 0E B G-M 4`VM- p@T' P (PT 00S+ P 0 S=-00 B=-ЍЍEX00X0L  8$0 XB  H1C- MR@; mP!]4P=U  qa@ p 0@U =00= Ѝ]=4PU  0 Ut00h i0]=4PU 0 U 0 iAB  \0= 4 RS -(͑=0/ G-P@(p`P2 @@$TYW qP @|@WGG0 _0 ZpRx@-J= 4PSMP   -P=0` 0 p 0 +=.0CRp ` ->-0S>0>U  R  1p}Ѝx A-@PM` +p( $ @c0 NЍp@-@ P`=PpVU0Pp0@0?P 0@-@MP 000S  ]P 00Ѝ0PP0 Rx R  P 0 P B? Pl08  0C0l B 8C-pQ M`/:M-\PT ꜐I(1T @T P P @TDD 0  ЍA0  O  R@-0  0S S S :6u0@- MR@  P p 0 0` `0 T0T @0* WЍ 00 0 B HP RC-PM7X20` R^  XPq4Bvp(!0wP P  wp(!p0d0: 10Ѝ`BV@BlY.Ӓ$ 0@@R  P=<1LCpP 3 0  5}CЍ`00@T#  P 00 `p0 i 0 0d p0 ^P 0D0< @0 T$`00 ,B P h@-@MT 8 80 0 0|Ѝ0 D+.RP /p@-P0M0S! @ PЍp 0S ``@P 0T0Pt0t  ЍpH 0S ``@PPP0  B   p@-0MΑ.<0\ ^  >QS00Ѝp0S 0 0@PU 0,3P 0,P`gp 0D0P 0 `V` $0- RB @-PM`@pP& 2PU 0,P 0,P`-"0D0"0 gl"0  Ѝw42P' RV  PEr00,0': > Q0 1 8 PPP jPPUR 0,P 0,PM`X10`p08! 0!  SЍ 1  0p0  0000`` 0|PP \0 00 "z`` $0 fB 4,A  Q0S/:>.Q 0 QR@-0 00/R0Q@-M S0@0T   Ѝ0, ,,   ЍR0@- M @PU P Ѝ0@h0 R  P Ѝ0400P,0,  Y0B 4e@-0S Q 00@T 0  SrXR @-(M0t( 0"P 1S0c#  c (Ѝ0@T P @h00@v?\  D0< @@0 vB dR,0@-@)06 @P DP :..<0Rp@-M 1@0`0 ZP'  P' 0P  PЍp0 R  2P | 0 0 l0\ X0D TTP00 L@ $0$3lA &B R!$ @0 0A- pPtF PMD`LE@P@0<0@0#80<@<P7ڶ30<30080#<L\-3<00 0W4#$0  @0 0ЍAI @0@ @@FD0CD B<P*LUtRxTp@-!0MS@`GPU8 <00CS1 IR'  P00P@ PE]U'@ 30CP 3@P Ѝp@薪0 0$!0 0!f0 0000f0t0 1 0 00X`ЍpR  :P t 0 0L ^0  H0>F,0^ ?B LUUR, 0p@-SM@ Q R 0S<1 R= P !00!0xЍpP@PEUP0`V) P P0  0 0Ѝp@x00P0T I@400y ,0 B x P0p@-@*1M S00P@#0@0PЍp [0`V P CX 0  0H w0400 0w B xO-@M0  (0$ 0P 0 0#@(00h000LP 80#<L P $0#-< 0<#0 #0P0h $0:00 S 0尢!lJ(`pP&pskWo0 00Sh @(3P2 Rg P 0 ( 0 " 0 " 2P OPP0M[@0S P 0Sh6P1 P#<00y l1W%P]) Ѝ$1 R? P!Ѝ 0 R, P 0 0 01000(000a 0 0h  D0CD B P*@0(00B x)9xT@-@W P<0# 0C B<00#J 0H:p@-NgMV@ 0SO P<A QT1 R> LP  `R= <0 0C 0` 1 !Ѝp@T #  !$$("($  $ 8"2| 03"t@PI 000P 9  ~ z ~ $   Op0W@H@F P ~!0 0!0; p `1XlY80T0 R* P `4!0 0z?  R* PTm0T0u< 0`00t0zdN` 0  0< h0N`00@0@ xB xTRtr=Lx(p@-FM@X00 `PP N`0 T03P0 TZTN SPЍpC-F M0X P 5 ЍR !\ A\ \ /R> R00S> /P> R R  R/R00 $1@-@MTpP`4 P `P0@(@0  LЍ@o/00S!R "R00S00S/@o/`PP0 B `@- M ` tPP0@rS sS0S0S pW  P/ 0S" Ѝ0xS Ѝ0S0SpW  P 9P 00 Ѝ( s#!<(00 Ѝ!p@-@ @1PP P`PpPp 06/p@-=@5 `P K/(u x A= PJRP600S06pp@-@6<5 `P (* %= JTP600S06p:@-6S- Q S "Q S "Q S "# R  5(   $ G-@MʌoV6 \3 ^0Qp0+]S P[ 0  0:?S>Y* )0Qp0P@@ Ѝ]SP0 S-0xSP L1D10B0S7 000 0:?S*  0 $}P(0S,0S0S0 R Q 0  00H00  z0( ((0 ON"R-$M00   I$ЍO-iMP1 0\ܑ1ᳰ0[Z P`4 `0 \S:0pP@[000M00L N0 P 배@[<`$pPP$ <R $  R  8LMN0110 S .`0000000 S  {iߍiߍY0h hh.^-@0 [P r0   ,R`O-@iMP n!Ა Y k QM `PR!I 0SI x1 `0p@ 0E 0 0P0H \S00S% P  0 Ⲡ<Z $vM A@`N @ V<$pPP@:0 S@0 iߍ Hiߍj0S0P |P00  0 0 ^ ,R00//@- = 0P@@- @10P00'00p@- P@ M00p@P 040@-0,="@P00@P 48 0@- @t,0@-@ 000@P 00@- @ M P 0 h 0  Ѝ0tp@-C S>C S=C  S=C Spp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{ *& *Z>>*SJ51:3//// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1- 0BC Ѝ0RP1/BİCİ / @-PpC--3#---3# R:0",S413`//ar$// *R:0",SJ413//ar$//SRQPM`-Ѝ /@-QC-P@P33<:Soo Uo oL| L~ l2xlUT33:0@T3 P\ 0f `@TP@P@P`V UT*@P`V4l5|h 5n0 6R@PY@G-L`LP`P`Fp&Fa@@0 3/Vl</@->w>M/var/lock/bts_rf_lockNot starting BTS due to RF_LOCK file present main.cSet global status #%d to %d (%04llx -> %04llx), LEDs: ACT %d Model specific options: -w --hw-version Print the targeted HW Version -M --pcu-direct Force PCU to access message queue for PDCH dchannel directlywMsysmobts was compiled for hw version 2.Abis closehw-versionpcu-direct"(6!*1l2hmsgb_l2len(msg) <= sizeof(l1p->u.phDataReq.msgUnitParam.u8Buffer)%s %s PH-DATA.req(%s) %s %s MQ_L1_WRITE queue full. Dropping msg. fl1h->phy_inst%s Rx PH-RTS.ind SAPI=%s %s MQ_L1_WRITE queue full. Dropping msg. %s PH-DATA-INDICATION for unknown sapi %s (%d) %s Rx PH-DATA.ind %s (hL2 %08x): %s, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s Rx PH-RA.ind, Meas: RSSI %-3.2f dBm, Qual %-3.2f dB, BER %-3.2f, Timing %d %s PH-RACH-INDICATION has %d bits msgb(%p): No room for primitive msgb(%p): No room for primitive data sys_primunknown MPH-INFO.req %d unknown prim %d op %d Rx L1 prim %s on queue %d l1_if.c:82Rx SYS prim %s Tx RF-MUTE.req (%d, %d, %d, %d, %d, %d, %d, %d) Ignoring Clock Calibration for selected %s clock Using external attenuator. %u.%u dsp %u.%u.%u fpga %u.%u.%uBTS band %s not supported by hw Operating without calibration; unable to load tables! Tx SET-TRACE-FLAGS.req (0x%08x) MQ_SYS_WRITE queue full. Dropping msg Rx L1-RESET.conf (status=%s) L1-RESET.conf with status %s L1-RESET failuresysmoBTSv2 L1IF compiled against API headers v%u.%u.%u struct femtol1_hdlFailed to read from EEPROM. Read clock calibration(%d) from EEPROM. Unable to read band support from EEPROM, assuming all bands Clock source defaulting to GPS 1PPS on sysmoBTS 2050 l1_if.c:1742l1_if.c:1749RfClockInfo iClkCor=%d/clkSrc=%s Err=%d/ErrRes=%d/clkSrc=%s Calibrating GPS against GPS doesn not make sense. No reference clock set. Please reset first. Couldn't determine the clock difference. Cannot open L1 interface Unknown/Unsupported sysmoBTS Model Number %u Assuming 1002 for sysmoBTS Model number %u Cannot determine nominal transmit power. Assuming 23dBm. lchan2lch_parfffg]^]L^]]         oml.c:1115%s : %s tch_mode=0x%02x oml.c%s Channel mode %s is not supported! %s MPH-CONFIG.conf (%s) setTxPower %f dBm Rx RF-MUTE.conf status=%s RF-MUTE failureACTIVE ACT_PENDING DEACT_PENDING cnf->u8Tn < TRX_NR_TS%s %s Rx mphConnectCnf flags=%s%s%s DSP L1 is no longer sending primitives! %s Rx mphDisconnectCnf BSIC=0x%08xBS_AG_BLKS_RES=%u MS Power Level 0x%02xamrCmiPhase=0x%02x amrInitCodec=0x%02x (%x %s Requested TS connect as %s, expected a specific pchan instead %s pchan=%s ts_connect_as(%s) logChComb=%s Close TRX %u %s cannot determine L1 SAPI oml.c:1064%s MPH-ACTIVATE.req (hL2=0x%08x, %s %s SET_CIPHERING (ALG=%u %s) oml.c:1356%s MPH-CONFIG.req (%s) cfgParams Tn=%u, subCh=%u, dir=0x%x oml.c:738oml.c:746%s all SAPIs already released? %s MPH-DEACTIVATE.req (%s Unimplemented command type %d oml.c:757struct sapi_cmd%s act failed mark broken due status: %d Queue is now empty. More pending.oml.c:785%s End of SAPI cmd queue encountered.%s Failed to find lchan for hLayer3=0x%x %s MPH-ACTIVATE.conf (%s Successful activation of L1 SAPI %s on TS %u Error activating L1 SAPI %s on TS %u: %s %s Got activation confirmation with empty queue %s Confirmation mismatch (%d, %d) (%d, %d) RX_REQ -> RX_CONF RX_CONF_TX_REQ -> RXTX_CONF RXTX_REQ -> RX_CONF_TX_REQ unhandled state %u %s Got ciphering conf with empty queue %s MPH-DEACTIVATE.conf (%s Successful deactivation of L1 SAPI %s on TS %u Error deactivating L1 SAPI %s on TS %u: %s %s Got de-activation confirmation with empty queue %s Trying to activate lchan, but commands in queue %s is now broken. Stopping the release. Rx %s, status: %s ====> trying to activate lchans of BCCH Rx MPH-INIT.conf (status=%s) Rx MPH-INIT.conf status=%s MPH-INIT failureUnsupported GSM band %s Init TRX (ARFCN %u, TSC %u, RxPower % 2f dBm, TxPower % 2.2f dBm Discarding adm change command: pending procedure on RC %d %s modifying channel for handover %s already in release request state. %s TS disconnect Set NB TSCSet Tx power levelSet logical channel paramsConfigure ciphering paramssysmobts_vty.c:143 %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-thresh lower %u upper %u'.%sactivatePHY Clock Source: %s%sCannot find PHY link %u%sCannot find PHY instance %u%sDSP Version: %u.%u.%u, FPGA Version: %u.%u.%u%sGSM Band Support: enableddisabledFemto L1 DSP trace flags:%sDSP Trace %-15s %s%s nominal-tx-power %d%s dsp-trace-flag %s%s clock-calibration eeprom%s clock-calibration %d%s trx-calibration-path %s%s clock-source %s%s|trx <0-0> dsp-trace-flag (Transceiver related commands TRX number DSP Trace Flag no trx <0-0> dsp-trace-flag (Negate a command or set its defaults Transceiver related commands TRX number DSP Trace Flag dsp-trace-flag (no dsp-trace-flag (Negate a command or set its defaults DSP Trace Flag no trx <0-0> <0-7> loopback <0-1>Negate a command or set its defaults Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> <0-7> loopback <0-1>Transceiver related commands TRX number Timeslot number Set TCH loopback Logical Channel Number trx <0-0> rf-clock-info correctTransceiver related commands TRX number RF Clock Information Apply trx <0-0> rf-clock-info resetTransceiver related commands TRX number RF Clock Information Reset the counter trx <0-0> tx-power <-110-100>Transceiver related commands TRX number Set transmit power (override BSC) Transmit power in dBm trx <0-0> <0-7> (activate|deactivate) <0-7>Transceiver related commands TRX number Timeslot number Activate Logical Channel Deactivate Logical Channel Logical Channel Number show phy <0-255> instance <0-255> system-informationShow running system information Transceiver related commands TRX number Display information about system HIDDENNegate a command or set its defaults Transceiver related commands TRX number Transceiver related commands TRX number show dsp-trace-flags trx <0-0>Show running system information Transceiver related commands TRX number Display the current setting of the DSP trace flagsshow phy <0-255> clock-sourceShow running system information Transceiver related commands TRX number Display the clock source for this TRXnominal-tx-power <0-100>Set the nominal transmit output power in dBm Nominal transmit output power level in dBm uplink-power-target <-110-0>Obsolete alias for bts uplink-power-target Target uplink Rx level in dBm trx-calibration-path PATHSet the path name to TRX calibration data Path name clock-source (tcxo|ocxo|ext|gps)Set the clock source value Use the TCXO Use the OCXO Use an external clock Use the GPS pps clock-calibration <-4095-4095>Set the clock calibration value Offset in PPB clock-calibration defaultSet the clock calibration value Default Clock DAC value clock-calibration eepromUse the eeprom clock calibration value       %s RTP IN: %s tch.cRTP HR frame length %u != expected %u Unhandled DTX DL AMR FSM state %d %s unable to parse RTP payload %s RTP->L1: %s %s %s chan_nr %d Rx Payload size 0 L1P-to-RTP%s %s DTX: received ONSET from L1 (%d bytes) %s %s DTX: received SID_FIRST_P1 from L1 (%d bytes) %s %s DTX: received SID_FIRST_P2 from L1 (%d bytes) %s %s DTX: received SID_FIRST_INH from L1 (%d bytes) %s %s DTX: received SID_UPDATE_INH from L1 (%d bytes) %s %s %s Rx Payload Type %s is unsupported L1 HR frame length %u != expected %u %s %s Unhandled payload type %s, generating empty RTP tick %s %s %s Rx Payload Type %s incompatible with lchan %s %s chan_nr %d Rx FACCH 8vHv/sys/class/leds/%s/brightnessactivity_ledonline_ledyyyyyyyz$z8zLz`z|v+ @Error reading RxCalibration from EEPROM, band=%d, ul=%d, err=%d calib_file.cError reading TxCalibration from EEPROM, band=%d, err=%d Reading an int from calib data failed. %f Reading a float from calib data failed. %s/%sFailed to open '%s' for calibration data. %s: u8IqImbalMode=%d FIXUPNO FIXUPUnable to read Ethenet MAC from EEPROM No calibration table fix-up needed, firmware < 3.3 MAC Address is %02x:%02x:%02x:%02x:%02x:%02x -> %s fileeepromL1 calibration table %s loaded (src: %s) L1 calibration table loading complete! No band_support?!? calib_rxu_850.cfgcalib_rxu_900.cfgcalib_rxu_1800.cfgcalib_rxu_1900.cfgcalib_rxd_850.cfgcalib_rxd_900.cfgcalib_rxd_1800.cfgcalib_rxd_1900.cfgcalib_tx_850.cfgcalib_tx_900.cfgcalib_tx_1800.cfgcalib_tx_1900.cfgr+/sys/bus/i2c/devices/i2c-1/1-0050/eepromeeprom fopeneeprom fseekeeprom fread %.4x| %.2x ;123456789:<=>@ABCDEFGHIJKLMNOPQRSUVWXYZ[\]^_`~~~~~~~~~ ~ /sys/devices/platform/i2c_davinci.1/i2c-1/1-0050/eepromComputed CRC(%d) wanted CRC(%d) sysmoBTS 1002sysmoBTS 1002+GPS+PoEsysmoBTS 2050 (master)sysmoBTS 2050 (slave)sysmoBTS 2050 (unknown)Unknownethaddrclk-factorytemp-dig-maxtemp-rf-maxserial-nrhours-runningboot-countkeymodel-nrmodel-flagstrx-nrError setting new correction value.successsysmobts_ctrl.c%d,%s,%d,%d,%sclock-correctionclock-infoprim_size_for_queueread_dispatch_one@`|Ȁ msgb->l1herror writing to L1 msg_queue: %s l1_transp_hw.cshort write to L1 msg_queue: %u < %u writing on a wrong queue: %d false1l_fdfailed to read from fd: %s [%d] unable to open %s for reading: %s [%d] unable to open %s for writing: %s /dev/msgq/superfemto_arm2dsp/dev/msgq/gsml1_sig_arm2dsp/dev/msgq/gsml1_tch_arm2dsp/dev/msgq/gsml1_pdtch_arm2dsp/dev/msgq/superfemto_dsp2arm/dev/msgq/gsml1_sig_dsp2arm/dev/msgq/gsml1_tch_dsp2arm/dev/msgq/gsml1_pdtch_dsp2arm,4<LMHP\ d x <\܃(Lh  Ԅ ,shadow(bts=%u,trx=%u,ts=%u%s)PDCH(bts=%u,trx=%u,ts=%u%s,pchan=%s as %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s switching %s -> %s)(bts=%u,trx=%u,ts=%u%s,pchan=%s)Physical Channel not configuredFCCH + SCH + BCCH + CCCH (Comb. IV)FCCH + SCH + BCCH + CCCH + 4 SDCCH + 2 SACCH (Comb. V)TCH/F + FACCH/F + SACCH (Comb. I)2 TCH/H + 2 FACCH/H + 2 SACCH (Comb. II)8 SDCCH + 4 SACCH (Comb. VII)Packet Data Channel for GPRS/EDGEDynamic TCH/F or GPRS PDCHUnknown / Unsupported channel combinationFCCH + SCH + BCCH + CCCH + CBCH + 3 SDCCH + 2 SACCH (Comb. V)7 SDCCH + 4 SACCH + CBCH (Comb. VII)Dynamic TCH/F or TCH/H or SDCCH/8 or GPRS PDCHNONECCCHCCCH+SDCCH4SDCCH8TCH/F_PDCHUNKNOWNCCCH+SDCCH4+CBCHSDCCH8+CBCHTCH/F_TCH/H_SDCCH8_PDCHBTS process timersabisAbis (RSL) related timerssysinfo.c%s: Unable to determine actual BS_AG_BLKS_RES value as SI3 is not available yet, fallback to 1 %s: Unable to determine actual NCH Position value as SI1 is not available yet. Disabling GPRS Indicator in SI (No PCU connected) Enabling GPRS Indicator in SI (PCU connected) Cannot parse SI4, hence not patching GPRS indicator $WOMLOC=%s INST=(%02x,%02x,%02x)msgb(%p): Not enough headroom msgb_push (allocated %u, head at %u < want headroom %u, len %u, tailroom %u) msgb->l3h%s: Sending FOM failed (no related BTS object found) %s: Tx %s %s: Sending %s to BSC: %s AVAIL STATE %s -> %s %s OPER STATE %s -> %s %s ADMIN STATE %s -> %s msgb(%p): msgb too small to pull %u (len %u) %s: Sending FOM NACK with cause %s %s: Sending FOM ACK %s: Failed to send ACK/NACK %s: Rx SET BTS ATTR New value for Attribute not supportedGiven ARFCN %u is not supported%s: Given ARFCN %u is not supported NM_ATT_START_TIME Attribute not supportedoml_bts_attroml.c:940oml.c:945%s: WARNING: Radio Link Timeout explicitly disabled, only use this for lab testing! %s: Given Conn. Failure Criterion not supported. Please use criterion 0x01 with RADIO_LINK_TIMEOUT value of 4..64 %s: Ignoring T200 BTS attribute. %s: T3105 must have a value != 0 %s: SET BTS ATTR: this BTS model does not support TSC %u != BSIC-BCC %u (TSC %u) %s: Rx SET RADIO CARRIER ATTR New value for Set Radio Attribute not supportedoml_trx_attroml.c:1138oml.c:1143%s: Set RF Max Power Reduction to %d dBm %s: Expecting only one ARFCN, because hopping not supported Given ARFCN %u is unsupported%s: Given ARFCN %u is unsupported OML-ack_nackUnknown/unhandled PCHAN type: %u %s %s: Rx SET CHAN ATTR New value for Set Channel Attribute not supported%s: SET CHAN ATTR: Frequency hopping not supported %s: SET CHAN ATTR: HSN and/or MAIO is missing: hsn=%u, maio=%u %s: SET CHAN ATTR: ARFCN list is missing %s: SET CHAN ATTR: ARFCN list is too long %s: SET CHAN ATTR: ARFCN list has odd length %s: SET CHAN ATTR: Starting time not supported oml_chan_attr%s: SET CHAN ATTR: invalid attribute value, rc=%d oml.c:1363oml.c:1369%s: SET CHAN ATTR: invalid Chan Comb 0x%x (pchan=%s, handle_chan_comb() returns %d) oml.c:1379%s: SET CHAN ATTR: this BTS model does not support TSC %u != BSIC-BCC %u oml.c:1397%s: SET CHAN ATTR (TSC=%d pchan=%s hsn=%u maio=%u chan_num=%uInitializing OML attribute definitions %s: Rx GET ATTR %s: Get Attributes for unknown Object Instance Get Attribute parsing failureGet Attribute without Attribute Listosmobtsmsgb(%p): msgb too small to get %u (len %u) %s: O&M Get Attributes [%u], %s is unsupported %s: Responding to O&M Get Attributes message with NACK 0%x %s: Rx CHG ADM STATE %s: Rx CHG ADM STATE: error during TLV parse %s: Rx CHG ADM STATE: no ADM state attribute %s: ADM state already was %s %s: ADM STATE %s -> %s %s: Rx IPA SET ATTR New value for IPAC Set Attribute not supported oml_ipa_attroml.c:1849Manufacturer O&M message too short Manufacturer OML message != ipaccess not supported msgb(%p): Negative length is not allowed Unexpected BTS %d in manufacturer O&M %s (exp. 0 or 0xFF)%s: TLV parse error %d %s: Rx IPACCESS(0x%02x): %s Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x for unknown TRX_NR=%u %s: Rx IPA RSL CONNECT IP=%s PORT=%u STREAM=0x%02x unknown Manufacturer O&M msg_type 0x%02xOML message too short Unsupported segmented O&M message Short OML message: %u < %u Formatted O&M message too short%s: GET ATTR with off-by-3 length: Fixing up for OS#3799 %s: OML message with %u extraneous bytes at end: %s Unexpected BTS %d in formatted O&M %s (exp. 0 or 0xFF)%s: Rx OPSTART %s: ... automatic ACK, OP state already was Enabled mo->fiunknown Formatted O&M msg_type 0x%02xunknown O&M msg_disc 0x%02x   27)L4m:Vs4<L\l|$     DX`ܙ@T|Ĝ0<\hȝ <HdtĞ̞$DPlx̟ܟ$d|Ԡ4xUpdated AGCH max queue length to %d bts.cstruct gsm_btsbts%dgprs_cell%d-0bts.c:292bts->features != NULL/tmp/pcu_btsbts->smscb_basic.ctrsbts->smscb_extended.ctrsrc == 0Main link established, sending NM Status AGCH: too many messages in queue, refusing message type %s, length = %d/%d Unhandled RSL channel type=0x%02x/rate=0x%02x %s BCCH carrier power reduction is not supported by this BTS model %s BCCH carrier power reduction value (%u dB) is incorrect or out of range %s BCCH carrier power reduction: %u dB (%s) DSP/HW based MS Power Control LoopMeasurement and Payload data combinedOML RadioChannel MO depends on RadioCarrier MOUplink interference measurementsBTS_TYPE_VARIANTBTS_SUB_MODELTRX_PHY_VERSIONunknownosmo-bts-lc15osmo-bts-oc2gosmo-bts-octphyosmo-bts-sysmoosmo-bts-trxosmo-bts-virtualosmo-bts-omldummyTime to wait between Channel Activation and dispatching a cached early Immediate AssignmentTime after which osmo-bts exits if regular ramp down during shut down process does not finish (s)Time after which osmo-bts exits if requesting transceivers to stop during shut down process does not finish (s)cbchcell broadcast channelcbch:rcvd_queuedReceived + queued CBCH messages (Abis)cbch:rcvd_droppedReceived + dropped CBCH messages (Abis)cbch:sent_singleSent single CBCH messages (Um)cbch:sent_defaultSent default CBCH messages (Um)cbch:sent_nullSent NULL CBCH messages (Um)base transceiver stationpaging:rcvdReceived paging requests (Abis)paging:dropDropped paging requests (Abis)paging:drop-psDropped paging requests (PS/PCU)paging:sentSent paging requests (Um)paging:congPaging congestion detected (Abis)rach:rcvdReceived RACH requests (Um)rach:dropDropped RACH requests (Um)rach:handoverReceived RACH requests (Handover)rach:vgcsReceived RACH requests (VGCS)rach:csReceived RACH requests (CS/Abis)rach:psReceived RACH requests (PS/PCU)agch:rcvdReceived AGCH requests (Abis)agch:sentSent AGCH requests (Abis)agch:deleteSent AGCH DELETE IND (Abis)rtp:rx:totalTotal number of received RTP packetsrtp:rx:markerNumber of received RTP packets with marker bit setrtp:rx:drop:preenTotal number of received RTP packets dropped during preeningrtp:rx:drop:loopbackTotal number of received RTP packets dropped during loopbackrtp:rx:drop:overflowTotal number of received RTP packets dropped during DL queue overflowrtp:rx:drop:v110_decTotal number of received RTP packets dropped during V.110 decodertp:tx:totalTotal number of transmitted RTP packetsrtp:tx:markerNumber of transmitted RTP packets with marker bit set bts_sm.c:44struct gsm_bts_smbts_smgprs_nse0gprs_nsvc%d-%dstruct gsm_bts_trx_tsbts_trx.cts != NULLtrx->ts[tn].mo.fi != NULLbts_trx.c:137bts_trx.c:140struct gsm_bts_trxbts%d-trx%d%s-ts%u(trx=NULL)(bts=%d,trx=%d)%u/%u/%u%s RSL link up Failed to establish RSL link (%d) GHrsl_rx_paging_cmdrsl_rx_sms_bcast_cmdrsl_rx_notification_cmdrsl_rx_osmo_etws_cmdrsl_rx_bs_pwr_ctrlrsl_rx_encr_cmdrsl_rx_ms_pwr_ctrlrsl_rx_meas_preproc_dftrsl_rx_bcch_inforsl_rx_ipac_dlcxrsl_rx_mode_modifrsl_rx_sacch_fillrsl_rx_sacch_inf_modrsl_rx_ipac_XXcxrsl_rx_imm_assrsl_rx_chan_activ%s Channel Mode IE is not present rsl.c%s Training Sequence IE is not present %s Channel Mode IE contains unknown 'Channel rate and type' value 0x%02x %s Channel Mode IE contains an unknown/unhandled combination of 'Speech or data indicator' 0x%02x and 'Speech coding algorithm/data rate' 0x%02x %s Channel type=0x%02x/mode=%s is not supported by the PHY %s BTS doesn't support cipher %s %s Encryption Info cannot have len=%d %s Setting lchan cipher algorithm %s %sunknown chan_nr=0x%02x %s %smismatching chan_nr=0x%02x %s This PHY does not support lchan TSC %u != BSIC-TSC %u, sending NACK %s Missing MultiRate conf IE (TCH mode is %s) %s Unexpected MultiRate conf IE (TCH mode is %s) %s Error parsing MultiRate conf IE RSLACTDEACT%s Tx PDCH %s NACK (cause = 0x%02x) %s (ss=%d) %s Tx CHAN ACT ACK 0x%02x: Tx MODE MODIFY NACK (cause = 0x%02x) Sending Channel Activated NACK: cause = 0x%02x Tx RSL Error Report: cause = 0x%02x size >= headroomRSL Radio Link Layer message too short Rx RLL %s for unknown lchan %s Rx RLL %s for lchan which isn't active %s Rx RLL %s Abis -> LAPDm RSL rx RLL: %s %s(): rsl_tlv_parse() failed BTS paging table is full%s %s(): chan nr is not Downlink CCCH FACCH copyETWS Primary Notification OFF rsl.c:981ETWS Primary Notification: %s rsl.c:991rsl.c:993%s Fast Power Control is not supported %s Failed to parse BS Power Parameters IE %s BS POWER CONTROL: attenuation change %u -> %u dB %s Fwd RSL ENCR CMD (Alg %u) to LAPDm %s Rx MS POWER CONTROL %u %s Failed to parse MS Power Parameters IE %s Unable to calculate power levels to dBm: %u -> %d, %u -> %d %s Rx Measurement Pre-processing Defaults rsl.c:1348rsl.c:1353rsl.c:1366rsl.c:1371struct gsm_power_ctrl_params Rx RSL SI 0x%02x not supported. Truncating received Full BCCH Info (%u -> %zu) for SI%s Rx RSL BCCH INFO (SI%s, %u bytes) Rx RSL SI2quater count updated: %u -> %d Rx RSL SI2quater with index %u > count %u Rx RSL SI2quater with impossible parameters: index %u, count %ushould be <= %u BCCH INFO Rx RSL BCCH INFO (SI%s) RX RSL Disabling BCCH INFO (SI%s) %s RSL Tx %s %s RSL Tx IPAC_DLCX_NACK %s RSL Tx IPAC_DLCX_ACK DLCX%s Tx MODE MODIF ACK Rx SACCH SI 0x%02x not supported. Truncating received SI%s (%u -> %zu) to prepend LAPDM UI header (2 bytes) Rx RSL SACCH FILLING (SI%s, %u bytes) Rx RSL Disabling SACCH FILLING (SI%s) %s Starting time not supported %s Rx SACCH SI 0x%02x not supported. %s Rx RSL SACCH FILLING (SI%s) %s Rx RSL Disabling SACCH FILLING (SI%s) CRCXMDCX0.0.0.0%s IPAC_%s: connect_ip=%s connect_port=%u speech_mode=%u payload_type=%u payload_type2=%u osmux_cid=%u rtp_extensions=%u %s Rx RSL IPAC %s, RTP_PT and RTP_PT2 in same msg !?! csd_fmt_d=%d csd_fmt_ir=%d %s Rx RSL IPAC %s, csd_fmt_d=%d is not supported %s Rx RSL IPAC XXcx without Osmux CIDgoes against configured Osmux policy 'only' %s Rx RSL IPAC MDCX, but we have no RTP socket! %s Rx RSL IPAC XXcx with Osmux CIDgoes against configured Osmux policy 'off' %s Rx RSL IPAC MDCX with Osmux CID, CRCX was configured as RTP! %s RSL Tx IPAC_%s_ACK (local %s:%u, remote %s:%u) Tx RSL RF RESource INDication Early IA check: %s (ss=%d) PDCH release: not in PDCH mode %s PCU rel ack for unexpected lchan kind %s %s not sending REL ACK %s (ss=%d) %s Tx CHAN REL ACK %s Sending HANDOver DETect %s Sending LISTENER DETect %s Sending TALKER DETect %s not sending CHAN ACT %s %s missing Activation Type %s error: lchan is not available, but in state: %s. %s error: reactivation on inactive lchan. %s rx chan activ but TS not in nm_state oper=ENABLED avail=OK, nack! chan nr 0x%x not covered by dyn_pchan_from_chan_nr() %s rx chan activ %s dyn_ts_l1_reconnect %s Cannot reconnect as pchan %s %s Disconnect lchan->pending_chan_activ == NULL%s Missing Handover Reference IE %s BS Power attenuation %u dB %s Error parsing SACCH INFO IE %s chan_nr=%s type=0x%02x=%s mode=%s %s Cannot send act ack: %d %s Activate via PCU %s Activate via PCU when PCU connects %s Sending Connection Failure: cause = 0x%02x Sending Channel Required %s Sending RTP delete indication: cause = %s %s Internal Error: both PDCH ACT and PDCH DEACT pending PDCH %s on dynamic TCH/F_PDCH returned error %d %s %s switched to %s mode (ts->flags == %x) %s Tx PDCH %s ACK Failed to transmit PDCH %s ACK, rc %d %s PDCH DEACT operation: channel disconnected, will reconnect as TCH %s PDCH ACT operation: channel disconnected, will reconnect as PDTCH %s Disconnected %s Dyn TS disconnected, but invalid desired pchan: %s %s Connect %s PDCH ACT IPA operation failed (%d) in bts model %s PDCH DEACT error: timeslot connected, so expecting lchan type TCH/F, but is %s %s PDCH DEACT operation: timeslot connected as TCH/F %s PDCH ACT error: timeslot connected, so expecting lchan type PDTCH, but is %s %s PDCH ACT operation: timeslot connected as PDTCH %s PDCH ACT OSMO operation failed (%d) in bts model %s Connected %s chan_num:%u Tx MEAS RES valid(%d), flags(%02x) %s Send Meas RES: NUM:%u, RXLEV_FULL:%u, RXLEV_SUB:%u, RXQUAL_FULL:%u, RXQUAL_SUB:%u, MS_PWR:%u, UL_TA:%u, L3_LEN:%u, TimingOff:%u []msg%s (%s) is not active. Dropping message (len=%u): %s %s RLL EST IND without contention resolution. %s Short GPRS SUSPEND REQ received, ignoring %s Fwd GPRS SUSPEND REQ for TLLI=0x%08x to PCU %s Fwd RLL msg %s from LAPDm to A-bis %s Scheduling %s to L3 in next associated TCH-RTS.ind %s Dropping pending release indication message ACT DEACTRSL message too short RSL Common Channel Management message too short RSL rx CCHAN: Rx RSL %s for unknown lchan %s Rx RSL %s %s unimplemented RSL cchan msg_type %s %s undefined RSL cchan msg_type 0x%02x RSL Dedicated Channel Management message too short %s ss=%d Rx RSL %s %s ss=%d state=%s Rx RSL RF Channel Release, but is already inactive; just ACKing the release %s Request to PDCH %s, but PDCH%s%s is still pending %s Request to PDCH %s, but lchan is still in state %s %s Attempt to PDCH %s on TS that is not a TCH/F_PDCH (is %s) %s Request to PDCH %s, but is already so %s unimplemented RSL dchan msg_type %s %s undefined RSL dchan msg_type 0x%02x undefined RSL TRX msg_type 0x%02x RSL ip.access message too short %s unsupported RSL ip.access msg_type 0x%02x unknown RSL msg_discr 0x%02x RSL rx DCHAN: RSL rx IPACC: struct rtp_abst_socketrtp_abstract.c:58rtp_abstract.c:69rtp_abstract.c:83Closing RTP socket on %s RTP session complete with %s rtp_abstract.cRx active for %u ticks twjit rx_packets=%u delivered_pkt=%u twjit handovers_in=%u handovers_out=%u twjit too_old=%u twjit underruns=%u twjit ho_underruns=%u twjit soft_underruns=%u twjit output_gaps=%u twjit thinning_drops=%u twjit duplicate_ts=%u twjit ssrc_changes=%u twjit seq_skips=%u twjit seq_backwards=%u twjit seq_repeats=%u twjit intentional_gaps=%u twjit ts_resets=%u Rx max jitter %u.%03u ms Rx %u RTP packets from wrong src Rx %u RTCP packets from wrong src Rx %u bad RTP packets (twjit) Rx %u bad RTP packets (after twjit) Rx wrong pt number (%u times) Rx failed to extract payload (%u times) Rx %u bad RTCP packets Rx RTCP RR for wrong SSRC (%u times) Tx %u RTP packets L4LLLL L M M MDMpLCopyright (C) 2010-2011 by Harald Welte, Andreas Eversberg and On-Waves Copyright (C) 2011-2022 by sysmocom - s.f.m.c. GmbH License AGPLv3+: GNU AGPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. %% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'no rxlev-avg'.%s%% rtp bind-ip is now deprecated%s%*sLower threshold (L_%s_XX_P): %u%s%*sUpper threshold (U_%s_XX_P): %u%s%*sLower threshold comparators: P%u=%02u / N%u=%02u%s%*sUpper threshold comparators: P%u=%02u / N%u=%02u%s%*sPre-processing algorithm: unweighted average%sweighted average%smodified median%sEWMA (alpha=%u)%sdisabled (pass-through)%sunknown%s%*sPre-processing parameters: Hreqave=%u / Hreqt=%u%s%*sPower control interval: %u ms (every %u SACCH block(s))%s%*sPower increase step size: %u%s%*sPower reduce step size: %u%s%*sRxLev measurement processing:%sRXLEV%*sRxQual measurement processing:%sRXQUAL%*sC/I measurement processing (FR/EFR):%sCI_FR%*sC/I measurement processing (HR):%sCI_HR%*sC/I measurement processing (AMR-FR):%sCI_AMR_FR%*sC/I measurement processing (AMR-HR):%sCI_AMR_HR%*sC/I measurement processing (SDCCH):%sCI_SDCCH%*sC/I measurement processing (GPRS):%sCI_GPRS%% Command '%s' has been deprecated.%s%% MS/BS Power control parameters should be configured in osmo-bsc: use 'rxlev-avg algo osmo-ewma beta %s'.%s%% Range end port (%u) must be greater than the range start port (%u)!%s%% Range must begin at an even port number! (%u is odd)%s%% Range must end at an odd port number! (%u is even)%s%% No such instance %u%s%% Unable to create phy%u instance %u%sphy %u%s%% Unknown BTS number %u (num %u)%s%% No such BTS (%d)%s%% Incorrect BCCH power reduction value, an even number is expected%s%% BCCH carrier power reduction operation mode is not supported for BTS (%d)%s%% can't find BTS '%s'%sinfinite%% INFINITE RADIO LINK TIMEOUT, USE ONLY FOR BTS RF TESTING%sonlyskip-nullrfc5993twrtptest message sent from VTY%% phy%s does not exist%s%% phy%s instance %s does not exit%s%% phy%s instance %s is already bound to %s%s%% The next unused TRX number is %u%s%% Unable to allocate TRX %u%svty.c:2420%% This command requires restart%svty.c:2403localhost/opt/poky-sdk/2.3.4/sysroots/armv5te-poky-linux-gnueabi/usr/local/jenkins-build/inst-osmo-bts-sysmo/include/osmocom/core/utils.h:127%% duplicate BSC (A-Bis/OML) ip address configured ('%s')%sstruct bsc_oml_hostvty.cbsc_oml_hostbsc_oml_host->addrOper '%s', Admin '%s', Avail '%s'%s(null)fall-backfrom BSCconnecteddisconnectedTRX %u of BTS %u is on ARFCN %u%sDescription: %s%s RF Nominal Power: %d dBm, reduced by %u dB, resulting BS power: %d dBm%s BS Power control parameters (%s):%s MS Power control parameters (%s):%s NM State: RSL State: %s%s Baseband Transceiver NM State: IPA stream ID: 0x%02x%sBTS %u, TRX %u, Timeslot %u, phys cfg %s, TSC %u (%s mode)%% can't find TRX '%s'%s%% can't find TS '%s'%ssapi >= 0sapi <= 31vty.c:2784uint16_tosmo%% BTS model 'osmo-bts-trx' has no DSP/HW MS Power Control support, consider updating your configuration file!%s%% This BTS model has no DSP/HW MS Power Control support%s%% Could not resolve logical channel%s%% BAND '%s' is not a valid GSM band%svty.c:705%% no such BSC (A-Bis/OML) ip address configured ('%s')%s as %s switching %s -> %sshadowprimaryBTS %u, TRX %u, Timeslot %u (%s) %s, Lchan %u, Type %s, State %s - RXL-FULL-ul: %4d dBm%s%d SACCH blocksThemyscira twrtpBelledonne ortpRTP library: %s%s%% this channel has no active RTP stream%s%% error setting jitter parameters: %s%s%% jitter parameters set: %d%sbs-power-ctrldynamiccurrent Error reason: staticendisBTS %u, TRX %u, Timeslot %u (%s), Lchan %u: Type %s%s Osmocom Dyn TS: IPACC Dyn PDCH TS: State: %s%s%s%s Channel Mode / Codec: %s%s CSD mode: %s%s AMR Multi-Rate Configuration: ICMI=%u, Start Mode=%u gsm48=%02x%02x%s AMR Mode %u (%s), threshold=%u, hysteresis=%u%s Bound IP: %s Port %u CONN_ID=%u Osmux_CID=%u%s RTP_TYPE2=%u%s Conn. IP: %s Port %u SPEECH_MODE=0x%02x RTP_TYPE=%u%s LAPDm SAPIs: DCCH %c%c, SACCH %c%c%s Valid System Information: 0x%08x%s MS Timing Offset: %d, propagation delay: %d symbols %s Ciphering A5/%u State: %s, N(S)=%u%s RTP/PDCH Loopback Enabled%s Radio Link Failure Counter 'S': %d%s Interference: %d dBm (band %d)%s%*sBS (Downlink) Power Control (%s mode):%s%*sChannel reduction: %u dB (max %u dB)%*sTRX reduction: %u dB%s%*sActual / Nominal power: %d dBm / %d dBm%s%*sPower Control parameters:%s%*sMS (Uplink) Power Control (%s):%s%*sCurrent power level: %u, %d dBm (max %u, %d dBm)%*sACCH repetition:%s%*sEnable RXQUAL threshold: %u%s%*sEnable RXQUAL threshold: (none, alway on)%s%*sDL-FACCH:%s%*sretramsit all LAPDM block types%s%*sretramsit only LAPDM command blocks%s%*sno retransmission (disabled)%s%*sretransmission currently active%s%*sretransmission currently inactive%s%*sDL-SACCH:%s%*sretramsit all SACCH blocks for SAPI=0%s%*sUL-SACCH:%s%*sTemporary ACCH overpower:%s%*sOverpower value: %u dB%s%*sSACCH overpower: %sabled%s%*sFACCH overpower: %sabled%s%*sRxQual threshold: disabled (overpower is always on)%s%*sRxQual threshold: %u%sno ts101318offbts %u%s description %s%s band %s%s auto-band%s ipa unit-id %u %u%s rtp jitter-buffer %u oml remote-ip %s%s adaptive rtp port-range %u %u%s rtp ip-dscp %d%s rtp socket-priority %d%s rtp library twrtp%s rtp continuous-streaming%s %srtp internal-uplink-ecu%s rtp hr-format %s%s paging queue-size %u%s paging lifetime %u%suplink %s-power-target %d hysteresis %d %s-power-filtering algo ewma beta %u%s no %s-power-filtering%s agch-queue-mgmt threshold %d low %d high %d%s gsmtap-remote-host %s%s gsmtap-local-host %s%s gsmtap-sapi %s%s gsmtap-rlp skip-null%s gsmtap-rlp%s min-qual-rach %d%s min-qual-norm %d%s max-ber10k-rach %u%s pcu-socket %s%s pcu-socket-wqueue-length %u%s supp-meas-info toa256%s smscb queue-max-length %d%s smscb queue-target-length %d%s smscb queue-hysteresis %d%s%sosmux%s%s use on%sonly%soff%s%s local-ip %s%s%s local-port %u%s%s batch-factor %d%s%s batch-size %u%s%s dummy-padding %s%s twjit%s trx %u%s user-gain %u mdB%s power-ramp max-initial %d mdBm%s power-ramp step-size %d mdB%s power-ramp step-interval %d%s ms-power-control %s%s ta-control interval %u%s phy %u instance %u%s[BTS %u, RAC %u, NSEI %u, BVCI %u%s Cell NM state: NSE NM state: NSVC%u (NSVCI %u) NM state: Address: r=%s%s%s:%u<->l=%s%s%s:%u%s%% can't find BTS %s%s%% can't find TRX %s%s%% can't find TS %s%s%% can't find LCHAN %s%sBTS %u is of type '%s', in band %s, has CI %u LAC %u, BSIC %u and %u TRX%s Description: %s%s Unit ID: %u/%u/0, OML Stream ID 0x%02x%s Site Mgr NM State: PCU version %s connected%s Paging: Queue size %u, occupied %u, lifetime %us%s AGCH: Queue limit %u, occupied %d, dropped %llu, merged %llu, rejected %llu, ag-res %llu, non-res %llu%s CBCH queue target: %d, hysteresis: %d, maximum: %d%s CBCH backlog queue length (BASIC): %d%s CBCH backlog queue length (EXTENDED): %u%s Paging: queue length %d, buffer space %d%s OML Link state: %s.%s PH-RTS.ind FN advance average: %d, min: %d, max: %d%s Radio Link Timeout (OML): %s%s Radio Link Timeout (OVERRIDE): %s%s BCCH carrier power reduction: %u dB%s TRX %u%s phy %d %s (%s) Features:%s %03u %-40s%s (not available)%s BTS model specific (internal) flags:%s%% Cannot find PHY link number %d%s%% Cannot find PHY instance number %d%sgsmtap-sapi (Enable sending of UL/DL messages over GSMTAP no gsmtap-sapi (Negate a command or set its defaults Disable sending of UL/DL messages over GSMTAP logging filter l1-sapi (Configure logging Filter log messages L1 SAPI no logging filter l1-sapi (Negate a command or set its defaults Configure logging Filter log messages L1 SAPI bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) value (current|max) <0-255>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change current power value Current value (for both dynamic and static modes) Maximum value (for dynamic mode only) BS power reduction (in dB) or MS power level bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> (bs-power-ctrl|ms-power-ctrl) mode (static|dynamic)BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number BS power control MS power control Change power control mode Disable the power control loop Enable the power control loop no bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackNegate a command or set its defaults BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> loopbackBTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number Set loopback bts <0-0> trx <0-255> ts <0-7> (lchan|shadow-lchan) <0-7> rtp jitter-buffer <0-10000>BTS related commands BTS number TRX related commands TRX number timeslot related commands timeslot number Primary logical channel commands Shadow logical channel commands logical channel number RTP settings Jitter buffer Size of jitter buffer in (ms) no instance <0-255>Negate a command or set its defaults Select a PHY instance to remove PHY Instance number Select a PHY instance to configure PHY Instance number phy <0-255>Select a PHY to configure PHY number %s(phy-inst)# %s(phy)# no gsmtap-rlpNegate a command or set its defaults Disable generation of GSMTAP frames for RLP (non-transparent CSD) gsmtap-rlp [skip-null]Enable generation of GSMTAP frames for RLP (non-transparent CSD) Skip the generation of GSMTAP for RLP NULL frames gsmtap-sapi (enable-all|disable-all)Enable/disable sending of UL/DL messages over GSMTAP Enable all kinds of messages (all SAPI) Disable all kinds of messages (all SAPI) no gsmtap-local-hostNegate a command or set its defaults Disable local bind for GSMTAP Um logging no gsmtap-remote-hostNegate a command or set its defaults Disable GSMTAP Um logging gsmtap-local-host HOSTNAMEEnable local bind for GSMTAP Um logging (see also 'gsmtap-sapi') Local IP address or hostname gsmtap-remote-host [HOSTNAME]Enable GSMTAP Um logging (see also 'gsmtap-sapi') Remote IP address or hostname ('localhost' if omitted) show lchan summary [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel Short summary BTS Number TRX Number Timeslot Number Logical Channel Number show lchan [<0-255>] [<0-255>] [<0-7>] [<0-7>]Show running system information Display information about a logical channel BTS Number TRX Number Timeslot Number Logical Channel Number show timeslot [<0-255>] [<0-255>] [<0-7>]Show running system information Display information about a TS BTS Number TRX Number Timeslot Number show trx [<0-255>] [<0-255>]Show running system information Display information about a TRX BTS Number TRX Number bts <0-0> c0-power-red <0-6>BTS Specific Commands BTS Number BCCH carrier power reduction operation Power reduction value (in dB, even numbers only) bts <0-0> radio-link-timeout (oml|infinite|<4-64>)BTS Specific Commands BTS Number Manually override Radio Link Timeout Use value provided by BSC via A-bis OML (Connection Failure Criterion) Use infinite timeout (DANGEROUS: only use during testing!) Number of lost SACCH blocks test send-failure-event-report <0-255>Various testing commands Send a test OML failure event report to the BSC BTS Number show bts <0-255> rtpShow running system information Display information about a BTS BTS Number RTP library selection show bts <0-255> gprsShow running system information Display information about a BTS BTS Number GPRS/EGPRS configuration show bts [<0-255>]Show running system information Display information about a BTS BTS Number phy <0-255> instance <0-255>Configure PHY Link+Instance for this TRX PHY Link number PHY instance PHY Instance numberta-control interval <0-31>Timing Advance Control Parameters Set TA control loop interval As in P_CON_INTERVAL, in units of 2 SACCH periods (0.96 seconds) (default=0, every SACCH block) ms-power-control (dsp|osmo)Mobile Station Power Level Control Handled by DSP Handled by OsmoBTS power-ramp step-interval <1-100>Power-Ramp settings Power increase by step Step time in seconds power-ramp step-size <1-100000> (dB|mdB)Power-Ramp settings Power increase by step Step size Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) power-ramp max-initial <-10000-100000> (dBm|mdBm)Power-Ramp settings Maximum initial power Value Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) user-gain <-100000-100000> (dB|mdB)Inform BTS about additional, user-provided gain or attenuation at TRX output Value of user-provided external gain(+)/attenuation(-) Unit is dB (decibels) Unit is mdB (milli-decibels, or rather 1/10000 bel) smscb queue-hysteresis <0-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Hysteresis of the SMSCB (CBCH) queue In count of messages/pages (default: 2) smscb queue-target-length <1-30>SMSCB (SMS Cell Broadcast) / CBCH configuration Target length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 2) smscb queue-max-length <1-60>SMSCB (SMS Cell Broadcast) / CBCH configuration Maximum length of the SMSCB (CBCH) queue Length in count of messages/pages (default: 15) no supp-meas-info toa256Negate a command or set its defaults Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods supp-meas-info toa256Configure the RSL Supplementary Measurement Info Report the TOA in 1/256th symbol periods pcu-socket-wqueue-length <1-2147483647>Configure the PCU socket queue length Queue length pcu-socket PATHConfigure the PCU socket file/path name UNIX socket path max-ber10k-rach <0-10000>Set the maximum BER for valid RACH requests BER in 1/10000 units (0=no BER; 100=1% BER) min-qual-norm <-100-100>Set the minimum link quality level of Normal Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) min-qual-rach <-100-100>Set the minimum link quality level of Access Bursts to be accepted C/I (Carrier-to-Interference) ratio in centiBels (10e-2 B or 10e-1 dB) uplink-power-filtering algo ewma beta <1-99>Configure filtering for uplink power control loop Select the filtering algorithm Exponentially Weighted Moving Average (EWMA) Smoothing factor (in %): beta = (100 - alpha) 1% - lowest smoothing, 99% - highest smoothing no uplink-power-filteringNegate a command or set its defaults Disable filtering for uplink power control loop uplink-power-target <-110-0> hysteresis <1-25>Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm Target Rx Level hysteresis Tolerable deviation in dBm Set the nominal target Rx Level for uplink power control loop Target uplink Rx level in dBm agch-queue-mgmt defaultAGCH queue mgmt Reset clean parameters to default values agch-queue-mgmt threshold <0-100> low <0-100> high <0-100000>AGCH queue mgmt Threshold to start cleanup in % of the maximum queue length Low water mark for cleanup in % of the maximum queue length High water mark for cleanup in % of the maximum queue length paging lifetime <0-60>Paging related parameters Maximum lifetime of a paging record Maximum lifetime of a paging record (secods) paging queue-size <1-1024>Paging related parameters Maximum length of BTS-internal paging queue Maximum length of BTS-internal paging queue (default 200) rtp hr-format (rfc5993|ts101318)RTP parameters HRv1 codec output format RFC 5993 TS 101 318 no rtp internal-uplink-ecuNegate a command or set its defaults RTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream rtp internal-uplink-ecuRTP parameters Apply a BTS-internal ECU to the uplink traffic frame stream no rtp continuous-streamingNegate a command or set its defaults RTP parameters Always emit an RTP packet every 20 ms rtp continuous-streamingRTP parameters Always emit an RTP packet every 20 ms rtp library (ortp|twrtp)RTP parameters RTP library selection Belledonne ortp Themyscira twrtp rtp socket-priority <0-255>RTP parameters Specify socket priority for RTP/IP packets The socket priority value (> 6 requires CAP_NET_ADMIN) rtp ip-dscp <0-63>RTP parameters Specify DSCP for RTP/IP packets The DSCP value (upper 6 bits of TOS) rtp port-range <1-65534> <1-65534>RTP parameters Range of local ports to use for RTP/RTCP traffic Port range start (inclusive) Port range end (inclusive) rtp jitter-buffer <0-10000> [adaptive]RTP parameters RTP jitter buffer Jitter buffer in ms Enable adaptive RTP jitter buffering rtp bind-ip A.B.C.DRTP parameters RTP local bind IP Address RTP local bind IP Address no oml remote-ip A.B.C.DNegate a command or set its defaults OML Parameters OML IP Address OML IP Address oml remote-ip A.B.C.DOML Parameters OML IP Address OML IP Address band (450|GSM450|480|GSM480|750|GSM750|810|GSM810|850|GSM850|900|GSM900|1800|DCS1800|1900|PCS1900)Set the frequency band of this BTS Alias for GSM450 450Mhz Alias for GSM480 480Mhz Alias for GSM750 750Mhz Alias for GSM810 810Mhz Alias for GSM850 850Mhz Alias for GSM900 900Mhz Alias for DCS1800 1800Mhz Alias for PCS1900 1900Mhz ipa unit-id <0-65534> <0-255>ip.access RSL commands Set the Unit ID of this BTS Site ID Unit ID bts BTS_NRSelect a BTS to configure BTS Number vty telnet-port <0-65535>Configure the VTY Set the VTY telnet port TCP Port number trx <0-254>Select a TRX to configure TRX number twjitConfigure TW jitter bufferdummy-padding (on|off)Dummy padding Enable dummy padding Disable dummy padding (default) batch-size <1-65535>Batch size Batch size in bytes batch-factor <1-8>Batching factor Number of messages in the batch local-port <1-65535>Osmux port UDP port local-ip (A.B.C.D|X:X::X:X)IP information IPv4 Address to bind to IPv6 Address to bind to use (off|on|only)Configure Osmux usage Never use Osmux Use Osmux if requested by BSC (default) Always use Osmux, reject non-Osmux BSC requests osmuxConfigure Osmux no auto-bandNegate a command or set its defaults Automatically select band for ARFCN based on configured band auto-bandAutomatically select band for ARFCN based on configured band %s(twjit)# %s(osmux)# %s(trx)# %s(bts)# OsmoBTSThis command applies for newly created lchansThis command applies when the TRX powercycles or restartsBSC Send PAGING for group %u, but number of paging sub-channels is only %u paging.cDropping paging, queue full (%u) Ignoring duplicate paging struct paging_recordpaging.c:254Add paging to queue (group=%u, queue_len=%u) Dropping paging for PS, queue congested (%u) short IMSI (%zu digits), will assume "000" to calculate paging group Add MAC block to paging queue (group=%u) etws_len < 128/8Paging called for GSM wrong time: FN %d/%d/%d/%d. paging.c:738Tx PAGING TYPE 3 (4 TMSI) Tx PAGING TYPE 2 (2 TMSI,1 xMSI) Tx PAGING TYPE 1 (1 xMSI,1 empty) Tx PAGING TYPE 1 (2 xMSI) paging.c:823Removed paging record, queue_len=%u Paging SI update struct paging_statepaging.c:896num_paging != 0 after flushing all records?!? ZZ &&@@gg33MMZg &3@MBFJNbX\ %s %s Unsupported lchan->tch_mode %u measurement.c%s %s meas period end fn_mod:%d, status:%d, pchan:%s SUBFULL%s %s measurement during state: %s, num_ul_meas=%d, fn_mod=%u %s %s no space for uplink measurement, num_ul_meas=%d, fn_mod=%u %s %s adding a %s measurement (ber10k=%u, ta_offs=%d, ci_cB=%d, rssi=-%u), num_ul_meas=%d, fn_mod=%u %s Calculating measurement results for physical channel: %s %s Received %u UL measurements, expected %u %s Received %u excess UL measurements %s Replaced %u measurements with dummy values, from which %u were SUB measurements %s Received UL measurements contain %u SUB measurements, expected at least %d %s Incorrect number of SUB measurements detected! (%u vs exp >=%d) %s Received UL measurements contain %u SUB measurements, expected %d %s Incorrect number of SUB measurements detected! (%u vs exp %d) %s Computed TA256(% 4d), BER-FULL(%2u.%02u%%), RSSI-FULL(-%3udBm), C/I-FULL(% 4d cB), BER-SUB(%2u.%02u%%), RSSI-SUB(-%3udBm), C/I-SUB(% 4d cB) %s UL MEAS RXLEV_FULL(%u), RXLEV_SUB(%u), RXQUAL_FULL(%u), RXQUAL_SUB(%u), num_meas_sub(%u), num_ul_meas(%u) i < lchan->meas.num_ul_meassq_diff_sum <= UINT32_MAXinactive => activeactive => inactive%s Temporary ACCH overpower: %s %s DL-FACCH repetition: inactive => active %s DL-FACCH repetition: active => inactive % -%s AMR MR Conf: num_modes=%uamr.c, mode[%u] = %u/%u/%uAMR CMI %u not part of AMR MR set RTP->L1: overriding CMR %u AMR Multirate IE is too short (%u) AMR Multirate Version %u unknown AMR Multirate with %u modes len=%u not possible %s T3115 timeout (%d resends left) asci.c%s is not active. It is in state %s. Ignoring %s NY2 reached, sending CONNection FAILure to BSC. %s VGCS RACH on dedicated channel type %s received with TA=%u, ref=%u %s Ignoring RACH, there is an active talker already. %s Failed to deactivate uplink access after TALKER DET. %s Starting T3115 with %u ms %s Channel is activated. %s Failed to activate uplink access after channel activation. %s Channel is activated for assignment. %s Failed to deactivate uplink access for assignment. %s First valid frame detected, talker now active. %s Uplink released, no talker. %s Failed to activate uplink access after uplink became free. ,$4$<$P$d$"#$#<#T#l#### #,###$$lchan.clchan_nr == 0lchan_nr < 2lchan_nr < 4lchan_nr < 8ts=%u,ss=%u Physical channel %s not expected! ts=%u,ss=%u Physical channel %s (0x%02x) not expected! (bts=%u,trx=%u,ts=%u%s,ss=%u)lchan.c:161%s Setting T200 D0=%u, D3=%u, S0=%u, S3=%u (all in frames) lchan%s SACCH no SI available %s state %s -> %s Channel Release%s: PDCH release requested but already in switchover %s Not enough room to store interference report (%ddBm) meas_num > 0%s Interference AVG: %ddBm (band %d, samples %u) %s Rx RSL IPAC CRCX, but we already have socket! %s IPAC Failed to create RTP/RTCP sockets %s IPAC Failed to create RTP/RTCP sockets%s IPAC Failed to set RTP socket parameters: %s %s IPAC set RTP socket parameters: %d failed to set DSCP=%d: %s failed to set socket priority %d: %s %s IPAC Failed to bind RTP/RTCP sockets %s IPAC Failed to bind RTP/RTCP socketsbts@%sOsmoBTS-1.11.0.21-351a%s Failed to connect RTP/RTCP sockets %s IPAC cannot obtain locally bound IP/port: %d %s freeing %d queued frames non-transparenttransparent @ 1200/75 bpstransparent @ 600 bpstransparent @ 1200 bpstransparent @ 2400 bpstransparent @ 4800 bpstransparent @ 9600 bpstransparent @ 14400 bpstransparent @ 29000 bpstransparent @ 32000 bpsRX_REQRX_CONFRXTX_REQRX_CONF_TX_REQRXTX_CONFACTIVATION REQUESTEDACTIVERELEASE REQUESTEDRELEASE DUE ERRORBROKEN UNUSABLELLMLMDM8.@. %s not (yet) provisioned pcu_sock.cA transceiver with ARFCN %u is not (yet) provisioned PCU socket has LOST connection PCU socket has LOST connectionPCUIF connection closed pcu_sock.c:1193pcu_sock_txPCU socket not created, dropping message PCU socket not connected, dropping message Sending info BTS is up BTS is down %s PCU interface (version %u) cannot handle more than %zu transceivers => skipped %s unavailable for PCU (op=%s adm=%s) %s PDCH on ts=%u is available (tsc=%u hopping=yes hsn=%u maio=%u ma_bit_len=%u) hopping=no arfcn=%u) PCU connects but we already have another active connection ?!? PCU socket connected to external PCU Sending rts request: is_ptcch=%d arfcn=%d block=%d Sending data indication: sapi=%s arfcn=%d block=%d data=%s Updating SI%s to PCU: %s Revoking SI%s from PCU Failed to send SI%s to PCU: rc=%d OsmoPCU version %s connected SI%s is not available on PCU connection Unknown TXT_IND type %u received ActivateDeactivateReceived %d bytes on PCU Socket, but primitive hdr size is %zu, discarding Received %zu bytes on PCU Socket, but primitive %s size is %zu, discarding pcu_prim->u.data_reqReceived PCU Prim for non-existent BTS %u Data request received: sapi=%s arfcn=%d block=%d data=%s Rx malformed DATA.req for PCH pcu_agchReceived PCU data request with not existing TRX %d Received PCU data request with not existing TS %u %s: Received PCU DATA request for non-PDCH TS %s: Received PCU DATA request for inactive lchan Received PCU data request with unsupported sapi %d pcu_prim->u.pag_reqPaging request received: chan_needed=%d length=%d (dropping message because support for PCU_IF_MSG_PAG_REQ is not yet implemented) pcu_prim->u.act_req%s request received: TRX=%d TS=%d %s request, but lchan is not of type PDTCH (is %s) %s request, but lchan in dyn TS is not configured as PDCH in lower layers (is %s) pcu_prim->u.txt_indpcu_prim->u.containerReceived %zu bytes on PCU Socket, but primitive container size is %zu, discarding Received unknown PCU msg type %d Sending RACH indication: qta=%d, ra=%d, fn=%d Paging identity too large (%d) PCU socket not created, ignoring paging message Sending DATA.cnf: sapi=%s msg_id=%08x struct pcu_sock_statestate->srv_linkPCUIFCould not create %s unix socket: %s Started listening on PCU socket (PCU IF v%u): %s PCH_2AGCH_2PHYS INFO%s Sending PHYSICAL INFORMATION to MS. handover.c%s T3105 timeout (%d resends left) %s is in not active. It is in state %s. Ignoring %s NY1 reached, sending CONNection FAILure to BSC. %s RACH on dedicated channel received, but ra=0x%02x != expected ref=0x%02x. (This is no bug) %s handover RACH received on %s?! %s RACH on dedicated channel type %s received with TA=%u, ref=%u %s failed to modify channel after handover %s Starting T3105 with %u ms %s First valid frame detected BDFH468:456789:;Incorrect OM hdr length value %d %zu msg_utils.cFOM header insufficient space %zu %zu %s failed to decode AMR RTP (length %zu, %p) %s unsupported AMR FT 0x%02x %s Have to send %s frame on TCH but SID buffer is empty - sent nothing Ipa header insufficient space %d %zu Incorrect ipa header msg size %d %zu IPA length shorter than OSMO header Om header insufficient space %d %zu Incorrect om mdisc value %x Incorrect om placement value %x %x Incorrect om sequence value %d No ManId Length Indicator %zu Insufficient message space for this ManId Length %d %zu Manuf Label Unknown tx_power.carfcn < ARRAY_SIZE(pa->calib.delta_mdB)%s ramp_timer_cb(cur_pout=%d, tgt_pout=%d, ramp_att=%d, therm_att=%d, user_gain=%d) %s ramping TRX board output power to %d mdBm. %s bts_model notifies us of %d mdBm TRX output power. However, it should be %d mdBm! , bypass%s power_ramp_start(cur=%d, tgt=%d%s) %s Asked to ramp power up to %d mdBm, which exceeds P_max_out (%d) %s target_power (%d mdBm) is below or equal to 'power ramp max-initial' power (%d mdBm) 7 8,8%s{%s}: Timer expired waiting for ramp down complete bts_shutdown_fsm.c%s{%s}: Timer expired waiting for TRX close %s{%s}: %s TRX closed, %u TRX remaining %s{%s}: %s Ramping down complete, %u TRX remaining %s{%s}: No TRX is operational, skipping power ramp down %s{%s}: Shutdown process completed successfully, exiting process osmo_fsm_register(&bts_shutdown_fsm) == 0%s{%s}: BTS is already being shutdown. %s{%s}: Shutting down BTS, exit %u, reason: %s fi=NULL%s{%s}: %s Received TRX close cb rc=%d BTS_SHUTDOWNBTS_SHUTDOWN_EV_STARTBTS_SHUTDOWN_EV_TRX_RAMP_COMPLBTS_SHUTDOWN_EV_TRX_CLOSEDWAIT_RAMP_DOWN_COMPLWAIT_TRX_CLOSEDEXIT++++++++++++++++++++!+++++++++++++++++(P@(P@l1sap_rtp_rx_cb\LLpLMLLM M ,M $M L M%u) l1sap.c%s Ignoring an Access Burst on %s: BER10k(%u) > BER10k_MAX(%u) %s Ignoring an Access Burst on %s: ToA(%d) exceeds the allowed range (%d..%d) %s Ignoring an Access Burst on %s: link quality (%d) below the minimum (%d) %s radio link timeout counter S is already 0 %s decreasing radio link timeout counter S=%d -> %d %s radio link timeout counter S reached zero, dropping connection %s increasing radio link timeout counter S=%d -> %d rc >= 0GSMTAPMPH INFOTCHDATA%s %s %s meas ind, ta_offs_256bits=%d, ber10k=%d, inv_rssi=%u, C/I=%d cB %s %s Skipping RTP frame with lost payload %s assuming active lchan, but state is %s %s Rx PH-DATA.ind chan_nr=%s link_id=0x%02x len=%d %s No lchan for chan_nr=%s %s There can be no DATA.ind on PTCCH/U. This is probably a bug of the BTS model you're using, please fix! %s UL-SACCH repetition: inactive => active %s UL-SACCH repetition: active => inactive %s %s Lost SACCH block l1sap_prim%s No lchan for PH-RTS.ind (chan_nr=%s) %s %s Rx TCH-RTS.ind bits_per_20ms != 0%s %s Tx TCH.req %s %s DL TCH Tx queue underrun msgb_l2len(msg) == 240%s %s Invalid TCH mode in TCH-RTS.ind under CSD NT PH-RTS-IND%s BTS model is sending us PRIM_INFO_TIME for TRX %u, please fix it %s Rx MPH_INFO time ind %s Invalid condition detected: Frame difference is %u-%u=%u > 1! unknown MPH_INFO ind type %d %s get_lchan_by_chan_nr(chan_nr=%s) yields NULL for PRIM_INFO_ACTIVATE.conf %s activate confirm chan_nr=%s trx=%d %s deactivate confirm chan_nr=%s trx=%d unknown MPH_INFO cnf type %d %s Rx PH-RTS.ind chan_nr=%s link_id=0x%02xd %s RTS without msg to be reused. Please fix! %s %s no looped PDTCH message, sending empty %s %s looped PDTCH message of %u bytes %s %s Forward RLL RELease INDication to the BSC %s DL-SACCH repetition: inactive => active %s DL-SACCH repetition: active => inactive rep_sacchrep_facch_0rep_facch_1%s Tx PH-DATA.req chan_nr=%s link_id=0x%02x %s No lchan for TCH.ind (chan_nr=%s) %s %s Rx TCH.ind msg->len == GSM_HR_BYTES%s Rx PH-RA.ind %s Access Burst for continuous Timing Advance control (toa256=%d) %s Access Bursts on PDTCH/U are not (yet) supported %s Attempting to set invalid Timing Offset value %d (MS TO = %u)! %s RACH for packet access (toa=%d, ra=%d) %s RACH for RR access (toa=%d, ra=%d) unknown prim %d op %d%s Rx -> RTP: %s TX packet data %s is_ptcch=%d trx=%d ts=%d block_nr=%d, arfcn=%d, len=%d %s %s(): incoming RTP truncated: %u -> %u -shadow%s Trying to activate already active channel %s %s Activating channel %s bts%u-trx%u-ts%u-ss%u%s%s Trying to deactivate already deactivated channel %s %s Deactivating channel %s %s Deactivating SACCH on channel %s %s Modifying channel %s ActivatingDeactivating%s Channel %s is not an active ASCI type channel. %s %s uplink access detection on channel %s (H0H= 0%s %s: deleting fully-transmitted message %p cbch.c:148%s %s: keeping fully-transmitted default message %p %s: Cannot process SMSCB of %u bytes (max %zu) struct smscb_msgRSL SMSCB COMMAND (chan=%s, type=%s, num_blocks=%u) RSL SMSCB COMMAND (chan=%s, type=%s): OVERFLOW cbch.c:223cbch.c:235cbch.c:242cbch.c:246%s: %s: Dequeued msg %s: %s: Using default msg %s: %s: No queued msg nor default NORMALSCHEDULEDEFAULTNULL &2    RaisingLoweringpower_control.c%s Rx UL Measurement Report: ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s Failed to calculate dBm for power ctl level %u on band %s %s Failed to retrieve power level for %d dBm on band %d %s Keeping MS power at control level %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s %s MS power control level %d (%d dBm) => %d (%d dBm): ms-pwr-lvl[curr %u, max %u], RSSI[curr %d, avg %d, thresh %d..%d] dBm, C/I[curr %d, avg %d, thresh %d..%d] dB %s Rx DL Measurement Report: RXLEV-FULL(%02u), RXQUAL-FULL(%u), RXLEV-SUB(%02u), RXQUAL-SUB(%u), DTx is %s => using %s %s Keeping DL attenuation at %u dB: max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] %s %s DL attenuation %u dB => %u dB:max %u dB, RSSI[curr %d, avg %d, thresh %d..%d] dBm, RxQual[curr %d, avg %d, thresh %d..%d] 0Uh8Ud@UDLUcXUshUTtUV|UeUiUtUrUO UO UO signal %u received BTS: SIGINT received -> shutdownSIGINTOsmoBTS contextsum-hc:d:Dc:sTVe:i:t:r:Some useful options: -h --help this text -d --debug MASK Enable debugging (e.g. -d DRSL:DOML:DLAPDM) -D --daemonize For the process into a background daemon -c --config-file Specify the filename of the config file -s --disable-color Don't use colors in stderr log output -T --timestamp Prefix every log line with a timestamp -V --version Print version information and exit -e --log-level Set a global log-level VTY reference generation: --vty-ref-mode MODE VTY reference generation mode (e.g. 'expert'). --vty-ref-xml Generate the VTY reference XML output and exit. Regression testing: --vty-test VTY test mode. Do not connect to BSC, do not exit.%s: Unknown VTY reference generation mode '%s' Generating the VTY reference in mode '%s' (%s) %s: error parsing cmdline options Command line argument '-r' is deprecated, use VTY cpu-sched node setting 'policy rr %d' instead. Command line argument '-i' is deprecated, use VTY parameter 'gsmtap-remote-host %s' instead. Command line argument '-t' is deprecated and does nothing, TRX number is calculated from the VTY automatically. ((*)) | / \ OsmoBTS --- VTY test mode: not connecting to BSC, not exiting --- Failed to create BTS Site Manager structure Failed to create BTS structure Setting SCHED_RR priority(%d) failed: %s unable to open bts Failed to parse the config file: '%s' You need to configure at least phy0 TRX %u has no associated PHY instance Command line argument '-i %s' overrides 'gsmtap-remote-host %s' from the config file main.c:356Setting up GSMTAP Um forwarding '%s'->'%s:%u' Failed during gsmtap_source_init2() Error initializing telnet PCU L1 socket failed Osmux setup failed osmo-btsunable to open PHY link(s) Error during daemonizehelpdebugdaemonizeconfig-filedisable-colortimestampversionlog-levelgsmtap-iptrx-numrealtimevty-ref-modevty-ref-xmlvty-testosmo-bts.cfgMWstruct phy_linkphy%u%s: PHY link state change %s -> %s phy_link.cstruct phy_instancepinst->trx == NULLpinst->trx->pinst == pinstphy_link.c:139phy_link.c:149phy%u.%u%s: This PHY instance is not associated with a TRX instance, check the configuration file! connectingWWWWWWWXdtx_dl_amr_fsm.cUnexpected event %d Inexpected event %d DTX_DL_AMR_FSMVoiceONSETFACCHCompleteFIRST P1->P2InhibitSID-FIRSTSID-UPDATESID-FIRST (P1)SID-FIRST (P2)SID-FIRST (Inh, SPEECH)SID-FIRST (Inh, FACCH)SID-UPDATE (Inh, SPEECH)SID-UPDATE (Inh, FACCH)SID-UPDATE (NoInh)SID-FIRST (Inh, SPEECH, Rec)SID-FIRST (Inh, FACCH, Rec)SID-UPDATE (Inh, SPEECH, Rec)SID-UPDATE (Inh, FACCH, Rec)SID-UPDATE (AMR/HR)ONSET (SPEECH)ONSET (FACCH)ONSET (SPEECH, Rec)ONSET (FACCH, Rec),3fP ff( f08hPh0PhPh0PhP h0P@hPh0{Pht\ h0n\0hg\h0a\hZ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                $$$$%%%%&&&&    """"    """"####$$$$%%%%&&&&####$$$$%%%%&&&&    !!!!""""    !!!!""""####$$$$%%%%&&&&####                                                               BCCH+CCCHBCCH+CCCH+SDCCH/4+SACCH/4BCCH+CCCH+SDCCH/4+SACCH/4+CBCHSDCCH/8+SACCH/8SDCCH/8+SACCH/8+CBCHTCH/F+SACCHTCH/H+SACCHlateearly%s Keeping current TA at %u: TOA was %d ta_control.c%s %s TA %u => %u: TOA was too %s (%d) nm_bts_sm_fsm.cosmo_fsm_register(&nm_bts_sm_fsm) == 0NM_BTS_SM_OPDISABLED_NOTINSTALLEDDISABLED_OFFLINEENABLEDnm_bts_fsm.cnm_bts_fsm.c:66osmo_fsm_register(&nm_bts_fsm) == 0NM_BTS_OPnm_bb_transc_fsm.c rsl phy opstart%s{%s}: Not connecting RSL in OML-DUMMY! %s{%s}: Error connecting IPA RSL: %d %s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s nm_bb_transc_fsm.c:63osmo_fsm_register(&nm_bb_transc_fsm) == 0NM_BBTRANSC_OPnm_channel_fsm.c%s{%s}: BSC trying to activate TS while still in avail=dependency. Allowing it to stay backward-compatible with older osmo-bts versions, but BSC is wrong. nm_channel_fsm.c:62osmo_fsm_register(&nm_chan_fsm) == 0NM_CHAN_OPDISABLED_DEPENDENCYnm_gprs_cell_fsm.cosmo_fsm_register(&nm_gprs_cell_fsm) == 0NM_GPRS_CELL_OPnm_gprs_nse_fsm.cosmo_fsm_register(&nm_gprs_nse_fsm) == 0NM_GPRS_NSE_OPnm_gprs_nsvc_fsm.cosmo_fsm_register(&nm_gprs_nsvc_fsm) == 0NM_GPRS_NSVC_OPnm_radio_carrier_fsm.c setattr%s{%s}: Delay switch to operative state Enabled, wait for:%s%s%s%s nm_radio_carrier_fsm.c:52osmo_fsm_register(&nm_rcarrier_fsm) == 0NM_RCARRIER_OPstruct asci_notificationAdded ASCI Notification for group call reference %s notification.cDeleting ASCI Notification for group call reference %s notification.c:91Deleting all %u ASCI Notifications of BTS notification.c:109gcr_bvchd_bv@ DRSLA-bis Radio Siganlling Link (RSL)DOMLA-bis Network Management / O&M (NM/OML)DRLLA-bis Radio Link Layer (RLL)DRRLayer3 Radio Resource (RR)DMEASRadio Measurement ProcessingDPAGPaging SubsystemDL1CLayer 1 Control (MPH)DL1PLayer 1 Primitives (PH)DDSPDSP Trace MessagesDPCUPCU interfaceDHOHandoverDTRXTRX interfaceDLOOPControl loopsDABISA-bis Intput SubsystemDRTPRealtime Transfer ProtocolDOSMUXOsmux (Osmocom RTP multiplexing)DASCIASCI (Advanced Speech Call Items: VGCS/VBS)OML link was closed early within %llu seconds. If this situation persists, please check your BTS and BSC configuration files for errors. A common error is a mismatch between unit_id configuration parameters of BTS and BSC. abis.cevent == ABIS_LINK_EV_SIGN_LINK_DOWNE1L(%u) Signalling link down OML Signalling link up RSL Signalling link for TRX%d up TRX%d does not exist! Input Signal %s received for ts-%u-%u link_type=%s %s{%s}: List of BSCs to connect to is empty! priv->current_bsc%s{%s}: BTS is shutting down, delaying A-bis connection establishment to BSC %s{%s}: No BSC available, A-bis connection establishment failed A-bis connection establishment to BSC (%s) in progress... eth0ipaevent == ABIS_LINK_EV_VTY_RM_ADDRDrop Tx OML msg, OML link is down msg->trxCannot determine remote IP Addr: %s sin.sin_family == AF_INETNo BSC configured, cannot start BTS without knowing BSC OML IP abis_linkbts->abis_link_fistruct abis_link_fsm_privabis_link_fsm_privosmo_fsm_register(&abis_link_fsm) == 0WAIT_RECONNECTCONNECTINGCONNECTEDFAILEDSIGN_LINK_OML_UPSIGN_LINK_DOWNVTY_RM_ADDRIPA/ABIS/OSMOABIS_OSMO_PCU message too short abis_osmo.cRx BSC->BTS%d ABIS_OSMO_PCU msg type %u OSMO message unknown extension %u Releasing unused osmux handle for %s osmux.cosmux.c:155osmux.c:156Cannot find Osmux input handle %p osmux sendto(%s) failed: %s OSMUXcannot allocate message cannot receive message Cannot find lchan for %s CID=%d %s received RTP frame too short (len = %d) Osmux CID %u is back to the pool 127.0.0.1*Failed binding Osmux socket to %s:%u Osmux socket listening on %s:%u All Osmux circuits are in use! Allocating Osmux CID %u from pool lchan->abis_ip.osmux.useosmux.c:448lchan->abis_ip.connect_ip != 0lchan->abis_ip.connect_port != 0Using existing OSMUX handle for rem_addr=%s osmux.c:179Created new OSMUX handle for rem_addr=%s %s Cannot allocate input osmux handle %s Cannot open osmux circuit %u struct osmux_handle%s RTP->L1: Dropping unexpected AMR encoding (bw-efficient?) %s rtp_input_preen.ccsd_rlp.cdata_len == 120data_len == 290<<$$csd_v110.clchan->tch_mode < ARRAY_SIZE(csd_v110_lchan_desc)data_len == CSD_V110_NUM_BITS(desc)(4@P`px     SW_ACTRX_SETATTRRX_OPSTARTOPSTART_ACKOPSTART_NACKSHUTDOWN_STARTSHUTDOWN_FINISHOML_UPRSL_UPRSL_DOWNPHYLINK_UPPHYLINK_DOWNDISABLEBBTRANSC_ENABLEDBBTRANSC_DISABLEDRCARRIER_ENABLEDRCARRIER_DISABLEDWrite Only attributeValue is out of rangeOK%uOOMmax-ber10k-rachoml-alertthermal-attenuation8qdnnn oDo|ooo0phplqZ%3j# Wf x] =,4o. P   `R`QoPPoo0M ]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]dn ndnh lndnndnlnn8om moL om  `$ p P <4P `> `$p  <P~ JMLo4 7E[xyS% 6 ,  p   g   f  $ ( , en0 1t4 ,8 ( ,<  @ ,\D VjF zG H  !P )SX *S\ +S` ,Sd .3h /,l ]1p  n n t ,=  6  'b ;<~=ttt%,  } $,|  66M,aaagO "tQ $t2 # 1,% 6,' :,   9 ,  ; ,  , *> /&,;a 6G  ;>  i - M   o MtT@7_Hv? 1 !_"#.$n%&g ' ()* +,- .Y / 01D23 4567889:; <v =. >% ?%@bA Be CDEF;G HJ IJcKLMNOnPQRSETUVWXYZw [\ ]^_` aE bS cUd e fg0h % x H   -p >\w> @ >#. p H Y O ` | +  9  E0 G P, Q,9  R T W,8 Y Ac> M!  > TKd E \  ^  _rev `,  a!  bK  c n, > i 3?KUWcg  o2? L{ K   n  ,@ , , ,  ,` ,5 ,@ ,j , , ,t ,s ,* ,V , , ,! , , , ,y , , , , ,. , , ,    P  > 4   }     >= ,\ uUX {> %vn  c  X   s ;(n ns ds (rpn qs Prs ys lz1h lz2h ,ih ?kh s h %<dpintO<,~ \\b w % w w}S (Q T*Q ,Q .Q "0 1 _=?C<`}5C%OCwCw:V7<8siW,=PwQxRy<}II7[(../sysdeps/arm/crtn.S/usr/src/debug/glibc/2.25-r0/git/csuGNU AS 2.28.0%% $ > $ > &I4: ; I?U%%%%%%%%%%%%%% $ > $ > : ; I  I&I : ;  : ; I8 : ;I8 : ; I !I/ <4: ;I?<4: ; I?<!'II& I: ; ( ': ;I I: ; : ; : ;I8 .?: ;'I@B: ;I: ;I4: ;I 4: ;I% $ > : ; I&I$ > I! I ' I 4: ; I?< ' .?: ; '@B.?: ; '@B: ; I4: ; I 4: ; IB1.?<n: ; U%U- ../sysdeps/armstart.Sp/1/11.11/22q.4/HB /usr/src/debug/glibc/2.25-r0/git/csuinit.ch, ../sysdeps/armcrti.Sp?/0////x]0=l ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.S'0/////0/1//0L/2f///////l ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.S) /00///0////00/00/10//0L/0/2///////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-df.S+/365//00////2/0////////301////3/1///3/3/ .1///////////0//2/5//3///1///1//50////2/////.0//0/3///2////20/5/20//2////1/////2/////2//3/0///20/00/10//02//1///0//0//2/// .0//0//0/// .0/04//2/ .0/04//02/ .///0///00/14/// .004/ .004/3/1/ ./1/0/0/0//////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-df.S/6//0///112//0///.//////401//////1////10/10///2////0//1//110//1////1/////////0/2////////0/2////////0/3/////0///0////0///2/0/10/2///10//////////0//22////2// .6//0///112//////////120/////1/////1/0//////0//////0//////0//0/////////2/////10/10/10////2//0//0///3/2/0/////////////////00/0////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-df.S3 ///////1////0/0///0/!m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.SL4:/3 .0////2/0///0301//0///02/22//1/3/3///1//1/5/0//2////.///5//403/0///100/0/10/02/1//0//0//2// .0///0/// ./3000110/ .00/300/3/10//10/./2/0////0/0////0/Dm ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S6/0///2130////.130//11//1/0/2/0///0//1//210/1///////0/3/0//////0/////2/0/10/2//10///////////0/22///2// ./0///212/////120/1/0//0//0//0//0/1/1/0/2//0//0///3/0//////0/////2//////////////00/0////m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S9/2/305//0/ .100200/6///////00.///5602/ .20//620//620//620//620/0m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S://///1///0/0/0////0/0/m ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armieee754-sf.S://////1///0/0/////0/h ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armbpabi.S@;L/gl ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/config/armlib1funcs.S|;  .//z ../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc-native/usr/lib/arm-poky-linux-gnueabi/gcc/arm-poky-linux-gnueabi/6.4.0/include/usr/include/bits/usr/include../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../include/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/gcc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/../gcc/config/armlibgcc2.cstddef.htypes.hlibio.hstdio.hsys_errlist.herrno.hunistd.hgetopt.htime.hhashtab.hinsn-constants.harm.harm-opts.hlibgcc2.h; t. .t.g J0/hJJ1I/I2LEiLOe/-0K2K0 /usr/src/debug/glibc/2.25-r0/git/csu/usr/src/debug/glibc/2.25-r0/recipe-sysroot-native/usr/lib/arm-poky-linux-gnueabi.gcc-cross-initial-arm/gcc/arm-poky-linux-gnueabi/6.4.0/includeelf-init.cstddef.h<.nf2f/ P, ../sysdeps/armcrtn.S]/=7 | ' | )  | @+ H T @.$ H J @.( H L @.@ X H $@/t F D F j | /l B4 1 B | <3T j | `L4  `5( T `6 F | 6  48`  | 9t LJ BN RB :$ JH ,: BH @: BH T: BH h: BH |: BH | :\ n | :T j | @;<TH |  |;D | H;(D | |<`B  |=long long intlong long unsigned int/usr/src/debug/glibc/2.25-r0/git/csuunsigned char/usr/src/debug/glibc/2.25-r0/git/csu/init.cGNU C11 6.4.0 -march=armv5te -marm -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -ftls-model=initial-execshort unsigned int_IO_stdin_usedshort intsizetypearm710tarm_arch_iwmmxt_shortbufARM_EQ_IO_lock_tarm600program_invocation_short_namestderrarm2_IO_buf_end__udivmoddi4arm6arm_fp_modelARM_PCS_AAPCS_IWMMXToptoptarm9BASE_ARCH_0BASE_ARCH_2BASE_ARCH_3BASE_ARCH_4BASE_ARCH_5BASE_ARCH_6BASE_ARCH_7cortexa15cortexa7fa606te_IO_write_endvfp_reg_typefmp626GNU C11 6.4.0 -march=armv5te -marm -mtls-dialect=gnu -g -g -g -O2 -O2 -O2 -feliminate-unused-debug-types -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hiddengetdate_errUSItype_flagsarm610arm10earm9ecortexa72cortexa53arm_ccfsm_statearm1022efa626unspec_stringscortexm0plussmallmultiply__clz_tabARM_VCarm_arch_xscalearm7tdmiscortexm0plusARM_VSARM_GEarm_tune_strongarmarm7complex floatARM_GTarm620regscortexa5cortexa8cortexa9__timezoneBASE_ARCH_7EMhashval_tBASE_ARCH_6KZarm740tarm_arch_arm_hwdiv_posarm_fpu_descstdoutall_fpus_IO_save_endopterr_cur_columnfa626tearm7dmistrongarm110BASE_ARCH_3Mmpcorenovfparm9tdmiarm_cond_codeARM_PCS_AAPCS_IO_backup_baseARM_PCS_AAPCS_LOCALarm_fpu_feature_setcortexr4cortexr5cortexr7cortexr8arm_arch_iwmmxt2VFP_NONE_fileno__pad2arm1156t2fs_sys_nerrprefer_neon_for_64bitscortexr4fsize_t_vtable_offset_markerscortexa12unspecv_stringscortexa15cortexa17_IO_read_basearm_arch3marm940tstdinarm920BASE_ARCH_4T_nextarm_regs_in_sequencereturn_used_this_functionBASE_ARCH_5TE_IO_markerarm1176jzfs_chainarm_lang_output_object_attributes_hookarm720tBASE_ARCH_5Earm7500fe_IO_2_1_stderr_processor_typearm_pcs_modearm_arch4tstrongarm1100arm700arm_tune_wbufhtab_hash_IO_read_ptrarm_arch_namecortexa32cortexa35arm_arch_notmarm_arch5eARM_LEBASE_ARCH_6JBASE_ARCH_6KBASE_ARCH_6MARM_LSARM_LT_IO_write_basestrongarm1110BASE_ARCH_6Zarm926ejsarm710_IO_2_1_stdin_arm_fpu_attr_IO_2_1_stdout__IO_save_basehtab_hash_pointerBASE_ARCH_5Tarm7500arm968esBASE_ARCH_7AARM_FP_MODEL_UNKNOWNARM_MIarm_arch6karm_arch6mBASE_ARCH_7R__popcount_tabarm920tarm720arm1136jshtab_eq__pad1arm946es__pad3__pad4__pad5ARM_PCS_AAPCS_VFParm_arch_no_volatile_cecortexa57BASE_ARCH_8Aarm700iARM_NEarm60featuresoptindARM_HIprogram_invocation_nameoptargARM_NVarm_arch4cortexm0smallmultiplyarm_arch6arm_arch7arm_arch8long doublecortexa57cortexa53/usr/src/debug/libgcc/6.4.0-r0/gcc-6.4.0/build.arm-poky-linux-gnueabi.arm-poky-linux-gnueabi/libgccarm_tune_xscalearm_arch5cortexa17cortexa7arm7di__quad_tmaking_const_tablethumb_call_via_labelarm1156t2s_IO_read_endARM_PCS_APCSARM_PCS_ATPCScomplex doublearm922tarm_cc../../../../../../../work-shared/gcc-6.4.0-r0/gcc-6.4.0/libgcc/libgcc2.cmpcorebase_architecturearm_arch_crcarm1176jzsarm_current_ccfa526cortexa72__environarm966es_IO_FILE_plusARM_PLmarvell_pj4BASE_ARCH_6T2BASE_ARCH_5TEJarm_tune_cortex_a9ARM_ALBASE_ARCH_7Marm_target_labelarm_target_insnarm250_lockxgene1pool_vector_labelarm1026ejs_old_offset_IO_FILEarm1136jfs_dont_use_rtx_here_arm70exynosm1UQItypeVFP_REG_D16arm_tunearm_cpp_interworkarm7d__tzname_sbufcortexm1smallmultiplyarm_arch_thumb_hwdiv_IO_write_ptrarm10tdmiARM_FP_MODEL_VFPhtab_eq_pointerarm7marm_pic_registerfa726teARM_CCarm_ld_schedarm810ARM_CSVFP_REG_SINGLEarm7dm__off_tgenericv7aarm_base_arch_sys_errlistarm_arch7emarm7100arm_pcs_defaultVFP_REG_D32ARM_PCS_UNKNOWNep9312arm3arm_arch_thumb2cortexm0cortexm1arm8cortexm3cortexm4arm7tdmicortexm7UDItype_flags2arm_none__daylightarm1020earm710cqdf24xx_unused2_IO_buf_basearm_arch8_1arm1020t__off64_t__init_array_startenvp/usr/src/debug/glibc/2.25-r0/git/csu/elf-init.c__libc_csu_fini__fini_array_end__init_array_end__preinit_array_start__fini_array_startargcsize__libc_csu_initargv__preinit_array_endGNU C11 6.4.0 -march=armv5te -marm -mtls-dialect=gnu -g -O2 -std=gnu11 -fgnu89-inline -feliminate-unused-debug-types -fmerge-all-constants -fno-stack-protector -frounding-math -fPIC -ftls-model=initial-execPQ(%RS(% PQRS(PQTUTUTUTU(TU`RS`VWRSDpQ\VvVvVH\'P'`W'Q'`X'R'`Y(,v2&,`V(4048T8LtL`Tpqx]]==]]= =Th.0MPP`Q `R x] ]   m  V  L  m\  ^\ <  mdn odn8 n m  t m  44,9 d9 `5m     ܿ  1p h ml Fl  m  Y  ( m8  m p| X mn n8 n ; ; Hmd d h $ 1|  m  Y   @ mP  m, ,  m p  m  ( mn n8 n << t< HXm4 4 < mL Lt  m  L mP YP x m  mL LL  m p<  m  m d , m o  o8 4o < 2< HJm8 8 P  [p  Y  m 4 m@ ~@X d m  m d  m p  m x H mT T  mDo Do8 lo <= t= `m    4 [P  p  Y  m  m ~   m  m t  m  p   m|o |o< o =   > `$m    [    18x  m Y  m  m ~  m  m 6 d mp pp  mo Ko< o $l> `> ` wm$ $ ( < [X  x  Y  m  m ~  m  m t  m, p,  mo o< p (? ! m`u ) `u  pu mu tv mv 9 v H v 0w m@w W @w z g ,{$ m,{ 8| mP| x P|D | m| } m} ,~ mP~ L m <  ld mЂ Ђ 8 ml ą mЅ  m   h m    m 8 m 8 mH < mX  m< ԣ m h m  m  mȧ  m    mī  8 m  m8  mH  mT  m    m 0 m4 l m  P P\- Q8 0Q  m> ? m? @ m@ $B m4B B mB B mB F mF HG mXG K m,K |K mK K mK P mP @Q mPQ U mU 8W m`W W B WB B tzzf,mW W mW Y (}(}8}  Tm0Y 0Y| Y mY Yh Z mZ  m> > ,A m\A \A D mE E H mI I@  tL mL Q mXR !XR @U m`U 3`U X mX MX x] m] ^] 8a mpa ppa h m8i 8i n mn n ~ m 8 m<  m, d mt  m  m | p m h m  m,  mȏ T md P md d@ 0 m  m| \ m|  m  m  m  mX x m  m,  m( X m  m, ( m  44Pd|&5УDSbq$8Ldx|N |N m (  m  m , m  x m ` x  (d D  R  e( }@ T l $    -4 E [X P m\ v\8  m   m  m, ,4  m` `( ( ( (  m H H8 -( A( VT u$( L( t( ( ( ( ( <$ %`  m B   m Yt l mx ix\ t     0  m C  m h  m   m   m UD  m   m H  m 4  m 4 H mL /L  m N4  m Z  m fl L m\ \l  m  8 mL L( t  m( (4 \4  | m *|   m  ;    m,  k ,   m  H   m P  m S l m h $ m8 84 ` 84 84 84 ml ld  m   m   m 6 p m KP  m h | m ul  m l \ mp p H mT T$ ` mx x8 4 t P mX X  m ! L  D% m<& G<&<  L0 mx1 5 x1 44 mh4 H h4 H7 ml7 C l7 7 m7 V 7 7 m7 a 7 \9 mp9 j p9 ? m$@ w $@ @ mA A@ /m| ĥ mȥ P mX  mا  m  m  m ` mx  m  m  m( ` U9 I/9 O U/O d/O Vs/mh  m  m̬  m  m0 D md  m  mȯ  mа  m  m l m 0 mD  m  mе  m L m`  m( ظ m  mĹ t m < mX l m X W9 / : hW/mx ȼ m̼ l Y/0/P`/`/`/0`0000-00<0K00Z0i00{x0t00n0g00a0Z,0mp  H0mD  m < mT  m  m 4 mD x m| 0m 0\ 0@ @  1m  m  LU1m !1 X mx 21x t m C1   mH  T1H `  m  l1  @  m`   m \ m` 4 mP  m  m  m P 1P 1

5ET5/l ]5559t 55Z, 5$ 5`}`5A 6<)696V6j66( 6( $6xT 66p` 6 78 7? 8)7| >74!  R7u777 ?077 7[D 8l 8J8Ф, e8888:T 888 9 939hd B9= R9h _9< m9  9s 9HP 9<  9lD 9$d 9l 9<  :): @:,r O:|L _:D$ r:::  ::WRp :;t ;; 8,;H A;s;h  ;;;;Du ;' ;4 <1<x E<I Y<t<@ < <<?, <X <<48` </t =Bx =q >5>`>X` w>>>>>?< ?H !? 6| -?J? Y?d{$ s? ?O ?:T ?X Ѕ  ?D ?d ?  ?.( @`4 @;@Q@ c@@ @@T @@s @At A  &A3AEAqAAAH A: L9=A< A9d A A BL B?BF` QBB<< 8B8B> BBB C0C BC\eCLH{Cr C CW CD C\C0( D|l *DJDoD DtT DD:$ DDE$"E@ExChZExE9 EE6 EI EE|;" EEF: )F:F4x CF  VFl) 8bF{FFFFt4 FP FGEGt  ZGqG( GGGG Hc< HH 2HDHHu  hHHHHHе I0IHD DI,hUIX hIhI, I\ I` IIw$ JCJ@-JPB (AJWJJ}` J9l J J4 JnH JJKT K`( -K@u\ 8KPKtKKKحT KK KT# K  L"LB  ;LP LL0 aLoL0b0 LLL`` L(0 L9l L;( LI M&Mw  EM`  \M<t oMT( M|HMM9t MM48` M N Nv 2Nl> 8BN ^ND oN) TzN, NI N NN NT4 ND NO4B (ODO4l XO lO}OOOO =O4XOhk P*P̗8 EPx( ZPmP( |PxB P PD PL PP|P"QDP /Q fAQ' OQfQH8 (|Q.$ Q3T QQ( QQR,$ RP &R,K 7R QR% ^RsRw, R@: RP, RR<  RR SX S(@ -SNSpSȧD SxL S?xS\ Sh(  S ST < ,T  5TLB CTH]OT.( [T lTTu` Th TT8 TTp8  U(U.$ 6U+ ?UcU~UU 7=U5  UD UUUV2V? 8CV 8 (\Vp)  mVH V V<= 8VH2 V|;" VA V^ VWX4 W0("W 8WKWX `WmWWWo W W9 8W WXpH(X <d 8X6 EXXl RXvXX<T Xh8 XX8X Y= 8Y h 2YaY t zYD YYYP Y$  Y\ Z"Z@Zl RZtZ\| 9< ZZ3T ZZ[@l@ ![3[ G[`W4 ][Ȓ n[t [  [9d [Ĺ [8o\ [̼ [uT \,: \<\( J\< ]\L4 k\|$ {\@ \ \  \O \ \\]LB  ]3] H]u]]l ]]L ]0 ]^-^ <^i^t| ^^ 0 ^T( ^^` ^)  ^B _0_N_9d V_t m_D8 _% __(/` _< __D `@ `2`  C`t``x ```` a&a 5a)< GaPP OaLh ^a+ ga<` wa0 a aPP iat4 aa  abb 'bP  7b| Pb8@ eb {bbL bH$ bb b< bc4'P (co 7cIc ]c`b qc1 zcc< ccx c, c c` d 'd@[g4( oggxD gh  g ggg h  #h(/` /hNhohh0d h h;hh\ iD i0iUiP  giod siLB ih| iiiiȥ i\ i "j@Zp 7j`j pjh jj jX\ jX j jkD #kX aPP 3k) Bkck zkTu  kkkS  k_ k< 8k< ll< 6l @lt Ylȑ klz:vlllH l/l ll E`m)m Bm\m{mX  m,m 6| m.@ mmm({< nnAn؇ Un enn/t nn4 nn,`  n oyt o>o:\ Ho \oXP qoo oT Pooop\4 +pKpf@ \p|pt ppppq q HDq Vq{qqqīD qq q ( r/r=r8h TrT: cr yr, rrr  rp] rd s s+  &s Nsjs\t sss4 s  s t tP?P-t WHHtU \t~ nt~ttte0 tu> u4$ .u  A4PP >uB PuT  huB( uuO uuuL uvv;v\vt4 ovX vvP vR vD vwL +wNwew T vwwH w^0 wT4 w,H w, w6 xD xа( xH /x ?xl NxI bx ~P oxا xx1 x